SitesBLAST
Comparing N515DRAFT_2296 FitnessBrowser__Dyella79:N515DRAFT_2296 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 89% coverage: 55:725/756 of query aligns to 12:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M81), G39 (= G82), Q40 (= Q83), H41 (≠ G84), V42 (≠ A85), A45 (≠ G88), G79 (= G127), G80 (= G128), S81 (= S129), S83 (≠ T131), V84 (≠ I132), G374 (= G406), F375 (= F407), L379 (= L411), L499 (≠ W525), R500 (= R526), V624 (= V631), D625 (≠ N632), Q632 (= Q639), T687 (≠ G694), G688 (= G695), L689 (≠ I696), G690 (= G697), E691 (= E698)
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 51% coverage: 206:591/756 of query aligns to 14:427/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
25% identity, 51% coverage: 206:591/756 of query aligns to 14:427/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
34% identity, 20% coverage: 590:739/756 of query aligns to 603:759/761 of 1rm6A
- active site: E718 (≠ T699), G719 (= G700)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V631), N647 (= N632), V651 (= V636), Q654 (= Q639), K714 (vs. gap), E715 (vs. gap), A716 (vs. gap), S717 (≠ E698), E718 (≠ T699)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
34% identity, 20% coverage: 590:739/756 of query aligns to 611:767/769 of O33819
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 46% coverage: 207:556/756 of query aligns to 4:380/420 of 3hrdE
- active site: Q207 (= Q376), L242 (= L411), R318 (≠ K486), H322 (≠ E495), R350 (= R526)
- binding calcium ion: T206 (= T375), N208 (≠ V377), D212 (≠ C381), K241 (≠ R410), L242 (= L411), D243 (≠ F412)
- binding pterin cytosine dinucleotide: G237 (= G406), F238 (= F407), R350 (= R526)
- binding selenium atom: F238 (= F407), A348 (≠ W524), F349 (≠ W525), R350 (= R526)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 46% coverage: 207:556/756 of query aligns to 4:380/420 of 3hrdA
- active site: Q207 (= Q376), L242 (= L411), R318 (≠ K486), H322 (≠ E495), R350 (= R526)
- binding pterin cytosine dinucleotide: G236 (= G405), G237 (= G406), F238 (= F407), R350 (= R526)
- binding magnesium ion: T206 (= T375), N208 (≠ V377), D212 (≠ C381), K241 (≠ R410), L242 (= L411), D243 (≠ F412), T305 (≠ G473), Y308 (≠ L476), A309 (= A477), S346 (≠ G519)
- binding nicotinic acid: A314 (≠ G482), R318 (≠ K486), F352 (≠ V528)
- binding selenium atom: F238 (= F407), G239 (= G408), A348 (≠ W524), F349 (≠ W525), R350 (= R526)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 46% coverage: 207:556/756 of query aligns to 5:381/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
24% identity, 45% coverage: 210:552/756 of query aligns to 545:901/1290 of 4uhxA
Sites not aligning to the query:
- active site: 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 237, 310, 311, 319, 320, 323, 324, 326, 329, 332, 333, 377, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
24% identity, 45% coverage: 210:552/756 of query aligns to 488:832/1221 of 8emtB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 210, 211, 213, 214, 216, 217, 218, 291, 292, 300, 304, 305, 307, 314
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
23% identity, 46% coverage: 204:552/756 of query aligns to 498:865/1254 of 8emtA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 215, 216, 217, 218, 219, 221, 222, 223, 296, 297, 306, 309, 310, 312, 319
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
31% identity, 17% coverage: 600:725/756 of query aligns to 183:316/330 of 3hrdB
- active site: E289 (= E698), P290 (≠ T699)
- binding pterin cytosine dinucleotide: I215 (≠ V631), N216 (= N632), M219 (≠ T635), V220 (= V636), Q223 (= Q639), K285 (vs. gap), G286 (= G695), V287 (≠ I696), G288 (= G697), E289 (= E698)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
31% identity, 17% coverage: 600:725/756 of query aligns to 183:316/330 of Q0QLF1
- 211:223 (vs. 627:639, 31% identical) binding
- AKGVGE 284:289 (≠ --GIGE 695:698) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
Q06278 Aldehyde oxidase; Aldehyde oxidase 1; Azaheterocycle hydroxylase; EC 1.2.3.1; EC 1.17.3.- from Homo sapiens (Human) (see 3 papers)
23% identity, 45% coverage: 210:552/756 of query aligns to 580:947/1338 of Q06278
- R802 (≠ Y402) to C: decreases homodimerization but nearly no effect on kinetic parameters; dbSNP:rs41309768
- AF 806:807 (≠ GF 406:407) binding
- R921 (= R526) to H: increases homodimerization; abolishes enzymatic activity on phenanthridine; decreases turnover number with benzaldehyde, phtalazine and chloroquinazolinone as substrate, while nearly no effect on the KM; dbSNP:rs56199635
Sites not aligning to the query:
- 44 binding ; C→W: Disrupts protein stability.
- 49 binding
- 52 binding
- 74 binding
- 113 binding
- 114 binding
- 117 binding
- 149 binding
- 151 binding ; binding
- 264:271 binding
- 345 binding
- 354 binding
- 358 binding
- 367 binding
- 411 binding
- 1047 binding
- 1088:1091 binding
- 1135 N → S: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs55754655
- 1203 binding
- 1268 binding
- 1269 G→R: No effect on dimerization. Loss of oxidase activity.
- 1271 S → L: no effect on dimerization; no effect on oxidase activity; dbSNP:rs141786030
- 1297 H → R: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs3731722
7orcB Human aldehyde oxidase in complex with raloxifene (see paper)
23% identity, 45% coverage: 210:552/756 of query aligns to 543:910/1299 of 7orcB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 326, 328, 331, 332, 376, 403
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding raloxifene: 417, 418, 419, 449, 451, 506, 507
O54754 Aldehyde oxidase 1; Azaheterocycle hydroxylase 1; Retinal oxidase; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
24% identity, 48% coverage: 200:563/756 of query aligns to 567:953/1333 of O54754
- V806 (≠ L411) mutation to E: Decreases substrate affinity and activity on benzaldehyde, phthalazine and acetaldehyde, while increases affinity for more hydrophobic aldehydes like retinal. Abolishes catalytic activity; when associated with R-884.
- M884 (= M484) mutation to R: Abolishes catalytic activity on phthalazine and acetaldehyde. Decreases catalytic efficiency on benzaldehyde and retinal. Abolishes catalytic activity; when associated with E-806.
Sites not aligning to the query:
- 1265 E→Q: Abolishes catalytic activity.
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
28% identity, 28% coverage: 345:556/756 of query aligns to 173:374/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
33% identity, 17% coverage: 597:724/756 of query aligns to 652:786/803 of P19913
Sites not aligning to the query:
- 384 modified: 4-hydroxyarginine
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
33% identity, 17% coverage: 597:724/756 of query aligns to 646:780/797 of 1ffvB
- active site: E751 (= E698), S752 (≠ T699)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C674 (= C627), I678 (≠ V631), I683 (≠ V636), Q686 (= Q639), K747 (≠ G694), G748 (= G695), V749 (≠ I696), A750 (≠ G697), E751 (= E698)
Sites not aligning to the query:
- active site: 231, 266, 343, 349, 378, 379
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 260, 261, 262, 263, 376, 378, 379, 516, 517, 518, 520, 523, 556, 557, 558, 560, 561
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
33% identity, 17% coverage: 597:724/756 of query aligns to 646:780/797 of 1ffuB
Sites not aligning to the query:
- active site: 231, 266, 343, 349, 378, 379
- binding cytidine-5'-diphosphate: 518, 520, 523, 558, 560, 561
Query Sequence
>N515DRAFT_2296 FitnessBrowser__Dyella79:N515DRAFT_2296
MNVRFDQPLGESQPDNPSRREALKLGGLVVAFLWLGGGAKVLGRAAAQGPVAAGDAAFAP
NAFIRVGTDGAVHLVMPSIEMGQGAYSGQATLLAEEMDLGLDQVVVEHAPANRKLYANPL
LGEQATGGSTTIRFCWTTLRQAGAAARALLVGAAAAKWKVDPAQCTVARGVIRHEASGRS
LGYGEVANAAAQLPVPDKVQEKDAAQFALIGKPLRRVDTAGKVDGSLQFGIDLRVPDMKV
ATVKACPTFGGKLVAVDDSRARQVPGFVAVLKIDNAVAAVGEHFWAAKQALDALDITWDH
GPNAQYSTEQLFKDLAEASKHGTPIPGKAVGNVDGVKGKALEATYQLPLLAHATMEPQNA
IVHVRPDGCDIWTGTQVPARCVDVAAKLTGLKPESIVVHNQYMGGGFGRRLFEDPVEQAV
AFARQVSYPLKMVWTREEDIAHDRYRPAYYDRIAATLGDDGKPVAWTHRIASGSVLATFA
PGAMGKNGMDSDAIECAADVPYEFPNMKVEWVRHDMPEGVHLGWWRGVGPVHNVFVVESF
MDELAHAAGKDPLVYRREQLQKNPRALGVLNLAAEKAGWGKGSLPARVGRGVAVAAPFGS
YLCVIVEAEVSPQGEVKLRRAVAAVDCGIAVNPNTVAAQVQGGLIFGWTAALYNGITIKH
GAVEQHNFNDYRMMRINETPALEVHLVDSKEAPGGIGETGTVMAFPALFNALFAATGVRL
RSYPIDRAALVQGPDALKAVITQATDRAAAAKEGMA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory