SitesBLAST
Comparing N515DRAFT_2307 FitnessBrowser__Dyella79:N515DRAFT_2307 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 64% coverage: 13:225/331 of query aligns to 19:241/348 of 3d31A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 82% coverage: 22:292/331 of query aligns to 45:325/378 of P69874
- F45 (= F22) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ E31) mutation to T: Loss of ATPase activity and transport.
- L60 (= L37) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ A46) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V100) mutation to M: Loss of ATPase activity and transport.
- D172 (= D137) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ A238) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (≠ A259) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
42% identity, 60% coverage: 25:224/331 of query aligns to 36:253/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
42% identity, 60% coverage: 25:224/331 of query aligns to 36:253/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
42% identity, 60% coverage: 25:224/331 of query aligns to 36:253/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
42% identity, 60% coverage: 25:224/331 of query aligns to 36:253/353 of Q97UY8
- S142 (= S114) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G116) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E138) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 58% coverage: 22:213/331 of query aligns to 34:244/375 of 2d62A
1g291 Malk (see paper)
38% identity, 58% coverage: 22:213/331 of query aligns to 31:241/372 of 1g291
- binding magnesium ion: D69 (vs. gap), E71 (vs. gap), K72 (vs. gap), K79 (≠ Q57), D80 (≠ Q58)
- binding pyrophosphate 2-: S38 (= S29), G39 (= G30), C40 (≠ E31), G41 (= G32), K42 (= K33), T43 (= T34), T44 (≠ L35)
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
42% identity, 55% coverage: 24:205/331 of query aligns to 32:229/241 of 4u00A
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 58% coverage: 22:213/331 of query aligns to 31:235/369 of P19566
- L86 (= L70) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P139) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D144) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
39% identity, 58% coverage: 22:213/331 of query aligns to 31:235/371 of P68187
- A85 (= A69) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ R88) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A93) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ W96) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E98) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (= A103) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G116) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D137) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ G206) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 58% coverage: 22:213/331 of query aligns to 32:236/393 of P9WQI3
- H193 (= H171) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
39% identity, 58% coverage: 22:213/331 of query aligns to 30:234/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
39% identity, 58% coverage: 22:213/331 of query aligns to 30:234/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S29), G38 (= G30), C39 (≠ E31), G40 (= G32), K41 (= K33), S42 (≠ T34), T43 (≠ L35), Q81 (= Q66), R128 (= R108), A132 (≠ S112), S134 (= S114), G136 (= G116), Q137 (= Q117), E158 (= E138), H191 (= H171)
- binding magnesium ion: S42 (≠ T34), Q81 (= Q66)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
39% identity, 58% coverage: 22:213/331 of query aligns to 30:234/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G30), C39 (≠ E31), G40 (= G32), K41 (= K33), S42 (≠ T34), T43 (≠ L35), R128 (= R108), S134 (= S114), Q137 (= Q117)
- binding beryllium trifluoride ion: S37 (= S29), G38 (= G30), K41 (= K33), Q81 (= Q66), S134 (= S114), G136 (= G116), H191 (= H171)
- binding magnesium ion: S42 (≠ T34), Q81 (= Q66)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
39% identity, 58% coverage: 22:213/331 of query aligns to 30:234/371 of 3puwA
- binding adenosine-5'-diphosphate: G38 (= G30), C39 (≠ E31), G40 (= G32), K41 (= K33), S42 (≠ T34), T43 (≠ L35), R128 (= R108), A132 (≠ S112), S134 (= S114), Q137 (= Q117)
- binding tetrafluoroaluminate ion: S37 (= S29), G38 (= G30), K41 (= K33), Q81 (= Q66), S134 (= S114), G135 (= G115), G136 (= G116), E158 (= E138), H191 (= H171)
- binding magnesium ion: S42 (≠ T34), Q81 (= Q66)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
39% identity, 58% coverage: 22:213/331 of query aligns to 30:234/371 of 3puvA
- binding adenosine-5'-diphosphate: G38 (= G30), C39 (≠ E31), G40 (= G32), K41 (= K33), S42 (≠ T34), T43 (≠ L35), R128 (= R108), A132 (≠ S112), S134 (= S114), Q137 (= Q117)
- binding magnesium ion: S42 (≠ T34), Q81 (= Q66)
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
39% identity, 58% coverage: 22:213/331 of query aligns to 28:232/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S29), G36 (= G30), C37 (≠ E31), G38 (= G32), K39 (= K33), S40 (≠ T34), T41 (≠ L35), R126 (= R108), A130 (≠ S112), S132 (= S114), G134 (= G116), Q135 (= Q117)
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
37% identity, 89% coverage: 24:316/331 of query aligns to 33:330/350 of 3fvqB
- binding adenosine-5'-triphosphate: S38 (= S29), G39 (= G30), C40 (≠ E31), G41 (= G32), K42 (= K33), T43 (= T34), T44 (≠ L35), R133 (= R108), E137 (≠ S112), S139 (= S114), G141 (= G116), Q142 (= Q117)
- binding calcium ion: T43 (= T34), Q86 (= Q66)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
38% identity, 61% coverage: 13:213/331 of query aligns to 25:230/353 of 1vciA
Sites not aligning to the query:
Query Sequence
>N515DRAFT_2307 FitnessBrowser__Dyella79:N515DRAFT_2307
MRIDYRIEHPVALHASFEVAGFTVLLGASGEGKTLLLSAIAGLIAARGEPFDGLPPQQRA
VGYLPQGHALFPHLRAWENVAFSLRGARRREQAMQWLERVGMAGLAERWPASLSGGQQQR
VALARALARRPSLLLLDEPTSALDPVTRDEVLAELIAEVHQAGIPALAVSHDPALAAVAD
RLVLMHGRRIVQIGTPEAVHAQPASGAVARLLGLRNVQRGRIVGAPGAQRLSWPEADASL
RVETALPDGTAVDWHVPPAAVRLHDPAAAPGDAIAASFELRQTSPHRNYLGMRCGKARLW
VEPPAGYELPAAPMLSLPPDAIRCWPVEEHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory