SitesBLAST
Comparing N515DRAFT_2310 FitnessBrowser__Dyella79:N515DRAFT_2310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6kgyB Hocl-induced flavoprotein disulfide reductase rcla from escherichia coli (see paper)
39% identity, 98% coverage: 3:448/456 of query aligns to 2:433/441 of 6kgyB
- active site: C43 (= C42), C48 (= C47), T51 (= T50), Y168 (= Y180), E172 (= E184), H426 (= H441), E431 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G12 (= G13), E33 (= E34), Q34 (≠ R35), M38 (≠ L37), G41 (= G40), T42 (= T41), G47 (= G46), C48 (= C47), A99 (= A116), N126 (= N139), T127 (≠ V140), G128 (= G141), G291 (= G307), D292 (= D308), F299 (= F315), T300 (= T316), Y301 (≠ H317), S303 (= S319), F333 (= F348)
6kyyA Cu(ii) complex of hocl-induced flavoprotein disulfide reductase rcla from escherichia coli (see paper)
39% identity, 97% coverage: 7:448/456 of query aligns to 2:424/432 of 6kyyA
- active site: C39 (= C42), C44 (= C47), T47 (= T50), Y159 (= Y180), E163 (= E184), H417 (= H441), E422 (= E446)
- binding copper (ii) ion: C39 (= C42), C44 (= C47), H226 (≠ K247), H229 (≠ G250), T291 (= T316)
- binding flavin-adenine dinucleotide: F7 (≠ A12), G8 (= G13), E29 (= E34), Q30 (≠ R35), M34 (≠ L37), T38 (= T41), C39 (= C42), C44 (= C47), K48 (= K51), A95 (= A116), N117 (= N139), T118 (≠ V140), G119 (= G141), I160 (= I181), R243 (= R268), D283 (= D308), F290 (= F315), T291 (= T316), S294 (= S319)
8ajjA Crystal structure of the disulfide reductase mera from staphylococcus aureus (see paper)
33% identity, 97% coverage: 5:446/456 of query aligns to 2:430/442 of 8ajjA
- binding flavin-adenine dinucleotide: G10 (= G13), E31 (= E34), Q32 (≠ R35), M36 (≠ L37), G39 (= G40), T40 (= T41), C41 (= C42), C46 (= C47), K50 (= K51), A97 (= A116), N126 (= N139), T127 (≠ V140), G128 (= G141), I169 (= I181), N255 (= N271), G290 (= G307), D291 (= D308), Q297 (≠ A314), F298 (= F315), T299 (= T316), Y300 (≠ H317), S302 (= S319)
- binding histidine: D353 (≠ E369), Y354 (≠ V370)
Sites not aligning to the query:
8ajkB Crystal structure of a c43s variant from the disulfide reductase mera from staphylococcus aureus (see paper)
32% identity, 97% coverage: 3:446/456 of query aligns to 3:433/447 of 8ajkB
- binding flavin-adenine dinucleotide: G11 (= G11), G13 (= G13), E34 (= E34), Q35 (≠ R35), M39 (≠ L37), G42 (= G40), T43 (= T41), G48 (= G46), C49 (= C47), K53 (= K51), K99 (≠ H115), A100 (= A116), N129 (= N139), T130 (≠ V140), G131 (= G141), G293 (= G307), D294 (= D308), Q300 (≠ A314), F301 (= F315), T302 (= T316), Y303 (≠ H317), S305 (= S319)
5x1yB Structure of mercuric reductase from lysinibacillus sphaericus (see paper)
30% identity, 96% coverage: 4:440/456 of query aligns to 3:448/454 of 5x1yB
- active site: A13 (≠ Q14), V37 (= V38), C41 (= C42), C46 (= C47), S49 (≠ T50), A74 (≠ E75), G75 (≠ D76), Y178 (= Y180), E182 (= E184), A318 (≠ Y320), A437 (= A429), Y439 (= Y431), E444 (= E436)
- binding flavin-adenine dinucleotide: I9 (= I10), G12 (= G13), I32 (= I33), E33 (= E34), R34 (= R35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K50 (= K51), A114 (= A116), T138 (≠ V140), G139 (= G141), Y178 (= Y180), R266 (= R268), G305 (= G307), D306 (= D308), F313 (= F315), V314 (≠ T316), A317 (≠ S319)
P16171 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Bacillus cereus (see paper)
30% identity, 96% coverage: 2:440/456 of query aligns to 167:614/631 of P16171
- Y264 (≠ E100) mutation to F: 30-fold decrease in activity. 300-fold decrease in activity; when associated with F-605.
- Y605 (= Y431) mutation to F: 10-fold decrease in activity. 300-fold decrease in activity; when associated with F-264.; mutation to H: 2-fold decrease in activity.
D9J041 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
30% identity, 96% coverage: 4:440/456 of query aligns to 84:529/546 of D9J041
- C122 (= C42) modified: Disulfide link with 127, Redox-active
- C127 (= C47) modified: Disulfide link with 122, Redox-active
6uziC Crystal structure of dihydrolipoyl dehydrogenase from elizabethkingia anophelis nuhp1
30% identity, 98% coverage: 1:448/456 of query aligns to 4:455/470 of 6uziC
- active site: C45 (= C42), C50 (= C47), S53 (≠ T50), V187 (≠ Y180), E191 (= E184), H448 (= H441), E453 (= E446)
- binding flavin-adenine dinucleotide: I12 (= I10), G13 (= G11), G15 (= G13), P16 (≠ Q14), G17 (≠ A15), E36 (= E34), K37 (≠ R35), G43 (= G40), T44 (= T41), C45 (= C42), G49 (= G46), C50 (= C47), S53 (≠ T50), K54 (= K51), V117 (≠ H115), G118 (≠ A116), T147 (≠ V140), G148 (= G141), I188 (= I181), R276 (= R268), D316 (= D308), M322 (≠ A314), L323 (≠ F315), A324 (≠ T316)
- binding zinc ion: H448 (= H441), E453 (= E446)
1ebdA Dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase (see paper)
32% identity, 97% coverage: 6:447/456 of query aligns to 5:446/455 of 1ebdA
- active site: P13 (≠ Q14), L37 (≠ V38), C41 (= C42), C46 (= C47), S49 (≠ T50), N74 (≠ D76), V75 (≠ T77), Y180 (= Y180), E184 (= E184), S320 (≠ Y320), H438 (= H439), H440 (= H441), E445 (= E446)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), P13 (≠ Q14), V32 (≠ I33), E33 (= E34), K34 (≠ R35), G39 (= G40), V40 (≠ T41), C41 (= C42), G45 (= G46), C46 (= C47), K50 (= K51), E112 (≠ H115), A113 (= A116), T141 (≠ V140), G142 (= G141), Y180 (= Y180), I181 (= I181), R268 (= R268), D308 (= D308), A314 (= A314), L315 (≠ F315), A316 (≠ T316)
P11959 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
32% identity, 97% coverage: 6:447/456 of query aligns to 11:452/470 of P11959
- 39:47 (vs. 34:42, 44% identical) binding
- K56 (= K51) binding
- D314 (= D308) binding
- A322 (≠ T316) binding
5u8uD Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa (see paper)
32% identity, 98% coverage: 1:448/456 of query aligns to 3:460/477 of 5u8uD
- active site: P16 (≠ Q14), L47 (≠ V38), C51 (= C42), C56 (= C47), S59 (≠ T50), G85 (≠ D76), V86 (≠ T77), V193 (≠ Y180), E197 (= E184), S333 (≠ Y320), F451 (≠ H439), H453 (= H441), E458 (= E446)
- binding flavin-adenine dinucleotide: I12 (= I10), G15 (= G13), P16 (≠ Q14), G17 (≠ A15), E36 (= E34), K37 (≠ R35), G49 (= G40), T50 (= T41), C51 (= C42), G55 (= G46), C56 (= C47), K60 (= K51), H123 (= H115), G124 (≠ A116), A152 (≠ N139), S153 (≠ V140), G154 (= G141), I194 (= I181), R281 (= R268), G320 (= G307), D321 (= D308), M327 (≠ A314), L328 (≠ F315), A329 (≠ T316), H330 (= H317), H453 (= H441), P454 (= P442)
Sites not aligning to the query:
P14218 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of 2-oxoglutarate dehydrogenase complex; EC 1.8.1.4 from Pseudomonas fluorescens (see 2 papers)
32% identity, 98% coverage: 1:448/456 of query aligns to 1:458/478 of P14218
- M1 (= M1) modified: Initiator methionine, Removed
- 34:49 (vs. 34:42, 31% identical) binding
- C49 (= C42) modified: Disulfide link with 54, Redox-active
- C54 (= C47) modified: Disulfide link with 49, Redox-active
- K58 (= K51) binding
- G122 (≠ A116) binding
- D319 (= D308) binding
- A327 (≠ T316) binding
5u8wA Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa bound to nadh (see paper)
32% identity, 98% coverage: 2:448/456 of query aligns to 1:457/473 of 5u8wA
- active site: P13 (≠ Q14), L44 (≠ V38), C48 (= C42), C53 (= C47), S56 (≠ T50), G82 (≠ D76), V83 (≠ T77), V190 (≠ Y180), E194 (= E184), S330 (≠ Y320), F448 (≠ H439), H450 (= H441), E455 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G12 (= G13), P13 (≠ Q14), G14 (≠ A15), E33 (= E34), K34 (≠ R35), G46 (= G40), T47 (= T41), C48 (= C42), G52 (= G46), C53 (= C47), K57 (= K51), H120 (= H115), G121 (≠ A116), A149 (≠ N139), S150 (≠ V140), G151 (= G141), S170 (≠ N160), G317 (= G307), D318 (= D308), M324 (≠ A314), L325 (≠ F315), A326 (≠ T316), H327 (= H317), Y357 (≠ F348), H450 (= H441), P451 (= P442)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I186 (≠ V176), G189 (≠ S179), V190 (≠ Y180), I191 (= I181), E194 (= E184), E210 (= E200), A211 (≠ R201), L212 (≠ S202), A275 (= A265), V276 (= V266), G277 (= G267), R278 (= R268), M324 (≠ A314), L325 (≠ F315), V355 (≠ S346), Y357 (≠ F348)
Sites not aligning to the query:
5u8vA Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa bound to NAD+ (see paper)
32% identity, 98% coverage: 3:448/456 of query aligns to 1:456/472 of 5u8vA
- active site: P12 (≠ Q14), L43 (≠ V38), C47 (= C42), C52 (= C47), S55 (≠ T50), G81 (≠ D76), V82 (≠ T77), V189 (≠ Y180), E193 (= E184), S329 (≠ Y320), F447 (≠ H439), H449 (= H441), E454 (= E446)
- binding flavin-adenine dinucleotide: I8 (= I10), G11 (= G13), P12 (≠ Q14), G13 (≠ A15), E32 (= E34), G45 (= G40), T46 (= T41), C47 (= C42), G51 (= G46), C52 (= C47), K56 (= K51), H119 (= H115), G120 (≠ A116), A148 (≠ N139), S149 (≠ V140), G150 (= G141), S169 (≠ N160), I190 (= I181), R277 (= R268), G316 (= G307), D317 (= D308), M323 (≠ A314), L324 (≠ F315), A325 (≠ T316), H326 (= H317), H449 (= H441), P450 (= P442)
- binding nicotinamide-adenine-dinucleotide: I185 (≠ V176), G186 (= G177), G188 (≠ S179), V189 (≠ Y180), I190 (= I181), L208 (≠ V199), E209 (= E200), A210 (≠ R201), V243 (≠ C234), V275 (= V266), G276 (= G267)
Sites not aligning to the query:
P18925 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Azotobacter vinelandii (see 2 papers)
30% identity, 98% coverage: 1:448/456 of query aligns to 1:458/477 of P18925
- 34:49 (vs. 34:42, 31% identical) binding
- C49 (= C42) modified: Disulfide link with 54, Redox-active
- C54 (= C47) modified: Disulfide link with 49, Redox-active
- K58 (= K51) binding
- D319 (= D308) binding
- A327 (≠ T316) binding
2eq6A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8
33% identity, 98% coverage: 3:448/456 of query aligns to 2:444/460 of 2eq6A
- active site: V37 (= V38), C41 (= C42), C46 (= C47), T49 (= T50), A176 (≠ Y180), E180 (= E184), H435 (= H439), H437 (= H441), E442 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), G12 (= G13), P13 (≠ Q14), G14 (≠ A15), E33 (= E34), A34 (≠ R35), G39 (= G40), V40 (≠ T41), C41 (= C42), G45 (= G46), C46 (= C47), K50 (= K51), F111 (≠ H115), A112 (= A116), A135 (≠ N139), T136 (≠ V140), G137 (= G141), S155 (≠ N160), R269 (≠ N271), D306 (= D308), L312 (≠ A314), L313 (≠ F315), A314 (≠ T316), H315 (= H317), Y344 (≠ F348)
Sites not aligning to the query:
4ywoA Mercuric reductase from metallosphaera sedula (see paper)
32% identity, 96% coverage: 9:448/456 of query aligns to 10:434/444 of 4ywoA
- active site: A15 (≠ Q14), I39 (≠ V38), C43 (= C42), C48 (= C47), S51 (≠ T50), A174 (≠ Y180), E178 (= E184), G308 (≠ Y320), H425 (= H439), F427 (≠ H441), E432 (= E446)
- binding flavin-adenine dinucleotide: G12 (= G11), G14 (= G13), K36 (≠ R35), G41 (= G40), T42 (= T41), C43 (= C42), G47 (= G46), C48 (= C47), K52 (= K51), A110 (= A116), A133 (≠ N139), T134 (≠ V140), G135 (= G141), N154 (= N160), L175 (≠ I181), L263 (= L275), G295 (= G307), D296 (= D308), M302 (≠ A314), L303 (≠ F315), E304 (≠ T316), A307 (≠ S319)
3ladA Refined crystal structure of lipoamide dehydrogenase from azotobacter vinelandii at 2.2 angstroms resolution. A comparison with the structure of glutathione reductase (see paper)
30% identity, 98% coverage: 2:448/456 of query aligns to 1:457/472 of 3ladA
- active site: L44 (≠ V38), C48 (= C42), C53 (= C47), S56 (≠ T50), V190 (≠ Y180), E194 (= E184), F448 (≠ H439), H450 (= H441), E455 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), G12 (= G13), P13 (≠ Q14), E33 (= E34), K34 (≠ R35), G46 (= G40), T47 (= T41), C48 (= C42), G52 (= G46), C53 (= C47), H120 (= H115), G121 (≠ A116), A149 (≠ N139), S150 (≠ V140), G151 (= G141), I191 (= I181), R278 (= R268), D318 (= D308), L325 (≠ F315), A326 (≠ T316)
P0A9P0 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes; Glycine cleavage system L protein; EC 1.8.1.4 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 97% coverage: 4:446/456 of query aligns to 6:450/474 of P0A9P0
- K220 (≠ D215) modified: N6-acetyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4jdrA Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase from escherichia coli (see paper)
30% identity, 97% coverage: 4:446/456 of query aligns to 5:449/471 of 4jdrA
- active site: P15 (≠ Q14), L40 (≠ V38), C44 (= C42), C49 (= C47), S52 (≠ T50), E77 (≠ S74), P78 (≠ E75), I184 (≠ Y180), E188 (= E184), V324 (≠ Y320), H442 (= H439), H444 (= H441), E449 (= E446)
- binding flavin-adenine dinucleotide: G12 (= G11), G14 (= G13), P15 (≠ Q14), A16 (= A15), E35 (= E34), R36 (= R35), Y37 (vs. gap), V43 (≠ T41), C44 (= C42), G48 (= G46), C49 (= C47), K53 (= K51), L115 (≠ H115), G116 (≠ A116), A144 (≠ V140), G145 (= G141), I185 (= I181), G311 (= G307), D312 (= D308), M318 (≠ A314), L319 (≠ F315), A320 (≠ T316), H321 (= H317)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_2310 FitnessBrowser__Dyella79:N515DRAFT_2310
MNQRFDAVVIGAGQAGPPLAERLGKAGRRVAVIERKLVGGTCVNTGCIPTKAMVASAYVA
HMAGRAHEYGVRGSEDTRVDMQRVWERTQGISGKARSGVEQWLVGMPNVTLLRGHARFES
PTTLRFGEDLIEAESFFINVGGRASVPDFPGIHDVPFLTNTGMMELRELPEHLMIVGGSY
IGLEFGQMFRRFGSKVTIVERSQRFLPREDADVADAVLAMLRDEGITVHLGAECIALEGK
AGAIRIKARGNQLCEQAVGTHLLLAVGRQPNTDDLGLDRAGVALDERGNIKVDDHGRSSV
PHIWAMGDCNGKGAFTHTSYNDFEIVADAVLGQGRRRISGRIQAYSLFTDPPLARIGMSE
QEARKSGREVLVGTRPMARVGRAVERGETVGFMKVVVDGASKELLGAAIFGVNGDEAIHC
LLDTMYAKAPYTTVSEAVHIHPTVAELLPTTLQSLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory