Comparing N515DRAFT_2392 FitnessBrowser__Dyella79:N515DRAFT_2392 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
45% identity, 86% coverage: 7:225/254 of query aligns to 3:220/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
46% identity, 89% coverage: 7:231/254 of query aligns to 1:229/232 of 1f3oA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
44% identity, 88% coverage: 6:228/254 of query aligns to 2:223/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
44% identity, 88% coverage: 6:228/254 of query aligns to 2:223/592 of 5lj7A
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
46% identity, 89% coverage: 7:231/254 of query aligns to 1:229/230 of 1l2tA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 87% coverage: 7:226/254 of query aligns to 4:222/648 of P75831
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
44% identity, 85% coverage: 12:228/254 of query aligns to 10:226/233 of P75957
7mdyC Lolcde nucleotide-bound
44% identity, 85% coverage: 12:228/254 of query aligns to 7:223/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
44% identity, 85% coverage: 12:228/254 of query aligns to 9:225/229 of 7v8iD
7arlD Lolcde in complex with lipoprotein and adp (see paper)
45% identity, 84% coverage: 12:225/254 of query aligns to 7:220/222 of 7arlD
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 92% coverage: 7:240/254 of query aligns to 4:232/650 of 5ws4A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
42% identity, 89% coverage: 5:230/254 of query aligns to 1:221/223 of 2pclA
8g4cB Bceabs atpgs high res tm (see paper)
36% identity, 86% coverage: 7:225/254 of query aligns to 3:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
36% identity, 86% coverage: 7:225/254 of query aligns to 2:220/245 of 7tchB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
42% identity, 91% coverage: 7:237/254 of query aligns to 2:230/241 of 4u00A
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 84% coverage: 8:220/254 of query aligns to 4:215/330 of P9WQK5
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
36% identity, 89% coverage: 6:230/254 of query aligns to 2:222/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
36% identity, 89% coverage: 5:230/254 of query aligns to 1:222/229 of 6z67B
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
41% identity, 80% coverage: 26:229/254 of query aligns to 19:221/225 of 8iddA
Sites not aligning to the query:
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
39% identity, 88% coverage: 7:229/254 of query aligns to 2:221/227 of 8igqA
>N515DRAFT_2392 FitnessBrowser__Dyella79:N515DRAFT_2392
MTDTANVITLRDLRKVFQTDEVETHALSDVHLSIARGEYVSISGPSGCGKTTLLSILGLL
DTATSGSFVLNGHDVATLNAAQRARIRNAEIGFIFQAFNLIGDLSVQENVELPLTYRSSI
GAAERRARVQEALERVGMAHRMRHYPAQLSGGQQQRVAVARALVGRPAILLADEPTGNLD
SRNGEAVMSLLDELHKGGATICMVTHDARYAELAQRKVRLFDGRVVDEETFDRLRREDES
RLEALIGQRIEVGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory