SitesBLAST
Comparing N515DRAFT_2399 FitnessBrowser__Dyella79:N515DRAFT_2399 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
48% identity, 99% coverage: 2:247/248 of query aligns to 3:248/249 of 4bmsF
- active site: S137 (= S136), H147 (≠ L146), Y150 (≠ L149), K154 (= K153), Q195 (≠ D194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ T14), S16 (= S15), I18 (= I17), R38 (≠ S37), R39 (≠ N38), A59 (= A58), D60 (= D59), V61 (≠ L60), N87 (= N86), S88 (≠ A87), G89 (= G88), V110 (≠ L109), S137 (= S136), Y150 (≠ L149), K154 (= K153), G181 (= G180), I183 (= I182), T185 (= T184), I187 (≠ F186)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
48% identity, 99% coverage: 2:247/248 of query aligns to 3:248/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S136), H147 (≠ L146), Y150 (≠ L149), L188 (≠ Y187), L246 (= L245)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ T14), S16 (= S15), G17 (= G16), I18 (= I17), R38 (≠ S37), R39 (≠ N38), D60 (= D59), V61 (≠ L60), N87 (= N86), S88 (≠ A87), G89 (= G88), V110 (≠ L109), T135 (= T134), S137 (= S136), Y150 (≠ L149), K154 (= K153), P180 (= P179), G181 (= G180), A182 (≠ T181), I183 (= I182), T185 (= T184), S187 (≠ F186)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
40% identity, 99% coverage: 2:247/248 of query aligns to 2:246/251 of 4esoB
- active site: G16 (= G16), S136 (= S136), M146 (≠ L146), Y149 (≠ L149), K153 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), T14 (= T14), H15 (≠ S15), M17 (≠ I17), R37 (≠ S37), N38 (= N38), N41 (≠ R41), S58 (≠ A58), D59 (= D59), I60 (≠ L60), N86 (= N86), A87 (= A87), G88 (= G88), T134 (= T134), S136 (= S136), Y149 (≠ L149), P179 (= P179), G180 (= G180), I182 (= I182), T184 (= T184), T186 (≠ F186), K187 (≠ Y187), G188 (≠ S188)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
37% identity, 99% coverage: 2:246/248 of query aligns to 8:253/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), S20 (≠ T14), K21 (≠ S15), G22 (= G16), I23 (= I17), A43 (vs. gap), S44 (vs. gap), S45 (≠ V35), G68 (≠ A58), D69 (= D59), V70 (≠ L60), N96 (= N86), S97 (≠ A87), G98 (= G88), Y100 (≠ S90), I144 (≠ T134), S146 (= S136), Y159 (≠ L149), K163 (= K153), P189 (= P179), G190 (= G180), M191 (≠ T181), I192 (= I182), T194 (= T184), G196 (≠ F186), T197 (≠ Y187)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S136), Y159 (≠ L149), M191 (≠ T181), I202 (≠ L192)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 3:253/256 of Q48436
- 6:33 (vs. 9:36, 32% identical) binding
- D59 (= D59) binding
- K156 (= K153) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 3:253/256 of 1gegE
- active site: G13 (= G16), S139 (= S136), Y152 (≠ L149), K156 (= K153), V197 (≠ L197)
- binding alpha-D-glucopyranose: R63 (≠ V63), D64 (≠ E64), F67 (≠ E67), E123 (≠ P123)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), Q12 (≠ S15), I14 (= I17), D33 (≠ G36), Y34 (≠ S37), V58 (≠ A58), D59 (= D59), V60 (≠ L60), N86 (= N86), A87 (= A87), I109 (≠ L109), S139 (= S136), Y152 (≠ L149), K156 (= K153), P182 (= P179), V185 (≠ I182), T187 (= T184), M189 (≠ F186)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
40% identity, 98% coverage: 1:244/248 of query aligns to 2:237/241 of 5t2uA
- active site: G17 (= G16), T135 (≠ S136), T145 (≠ L146), Y148 (≠ L149), K152 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), G17 (= G16), R38 (≠ S37), D39 (≠ N38), R42 (= R41), D60 (= D59), L61 (= L60), N83 (= N86), A84 (= A87), Y87 (≠ S90), I133 (≠ T134), T135 (≠ S136), Y148 (≠ L149), K152 (= K153), P178 (= P179), P180 (≠ T181), T181 (≠ I182), T183 (= T184), T185 (≠ L192), T186 (= T193)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 98% coverage: 2:245/248 of query aligns to 4:242/244 of 4nbuB
- active site: G18 (= G16), N111 (= N110), S139 (= S136), Q149 (≠ L146), Y152 (≠ L149), K156 (= K153)
- binding acetoacetyl-coenzyme a: D93 (≠ V92), K98 (≠ A97), S139 (= S136), N146 (≠ K143), V147 (≠ P144), Q149 (≠ L146), Y152 (≠ L149), F184 (≠ T181), M189 (≠ F186), K200 (≠ A203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (= I17), D38 (≠ G36), F39 (≠ S37), V59 (≠ A58), D60 (= D59), V61 (≠ L60), N87 (= N86), A88 (= A87), G89 (= G88), I90 (≠ A89), T137 (= T134), S139 (= S136), Y152 (≠ L149), K156 (= K153), P182 (= P179), F184 (≠ T181), T185 (≠ I182), T187 (= T184), M189 (≠ F186)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
38% identity, 99% coverage: 2:246/248 of query aligns to 7:251/258 of 4wecA
- active site: G21 (= G16), S143 (= S136), Q154 (≠ S147), Y157 (≠ L149), K161 (= K153)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), A19 (≠ T14), S20 (= S15), G21 (= G16), I22 (= I17), D41 (≠ G36), I42 (≠ S37), V61 (≠ A58), D62 (= D59), V63 (≠ L60), N89 (= N86), T141 (= T134), Y157 (≠ L149), K161 (= K153), P187 (= P179), P189 (≠ T181), V190 (≠ I182)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
37% identity, 98% coverage: 2:244/248 of query aligns to 6:248/259 of 6ci9D
- active site: G20 (= G16), S145 (= S136), Y159 (≠ L149)
- binding 1-aminopropan-2-one: F97 (≠ S90), S145 (= S136), T147 (≠ L138), W156 (≠ L146), Y159 (≠ L149), G190 (= G180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G12), S18 (≠ T14), G20 (= G16), I21 (= I17), G40 (= G36), R41 (≠ S37), N42 (= N38), D66 (= D59), V67 (≠ L60), N93 (= N86), G95 (= G88), T143 (= T134), S145 (= S136), Y159 (≠ L149), K163 (= K153), P189 (= P179), N191 (≠ T181), I192 (= I182), T194 (= T184), G196 (≠ F186), L197 (≠ Y187)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
35% identity, 98% coverage: 2:244/248 of query aligns to 44:288/292 of 3r3sA
- active site: G58 (= G16), S184 (= S136), L194 (= L146), Y197 (≠ L149), K201 (= K153), Q242 (≠ T198)
- binding magnesium ion: D56 (≠ T14), S57 (= S15), E82 (≠ V35)
- binding nicotinamide-adenine-dinucleotide: D56 (≠ T14), S57 (= S15), G58 (= G16), I59 (= I17), L79 (vs. gap), E82 (≠ V35), D106 (= D59), L107 (= L60), V133 (≠ N86), A134 (= A87), G135 (= G88), S184 (= S136), Y197 (≠ L149), K201 (= K153), P227 (= P179), G228 (= G180), I230 (≠ F186), T232 (≠ S188), L234 (≠ I190), Q235 (≠ G191)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 99% coverage: 1:246/248 of query aligns to 3:253/255 of 5itvA
- active site: G18 (= G16), S141 (= S136), Y154 (≠ L149), K158 (= K153)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (= I17), D38 (≠ G36), I39 (vs. gap), T61 (≠ A58), I63 (≠ L60), N89 (= N86), G91 (= G88), T139 (= T134), S141 (= S136), Y154 (≠ L149), K158 (= K153), P184 (= P179), G185 (= G180), I186 (≠ T181), I187 (= I182)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 98% coverage: 3:246/248 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G16), S142 (= S136), Y155 (≠ L149), K159 (= K153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G16 (= G16), I17 (= I17), D36 (≠ G36), I37 (≠ S37), A61 (= A58), D62 (= D59), T63 (≠ L60), N89 (= N86), A90 (= A87), M140 (≠ T134), S142 (= S136), Y155 (≠ L149), K159 (= K153), P185 (= P179), A186 (≠ G180), Y187 (≠ T181), I188 (= I182), L192 (= L192)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 99% coverage: 1:245/248 of query aligns to 1:245/247 of 4jroC
- active site: G16 (= G16), S142 (= S136), Q152 (≠ L146), Y155 (≠ L149), K159 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ T14), R15 (≠ S15), G16 (= G16), I17 (= I17), N35 (≠ V35), Y36 (≠ G36), N37 (≠ S37), G38 (≠ N38), S39 (vs. gap), N63 (≠ D59), V64 (≠ L60), N90 (= N86), A91 (= A87), I93 (≠ A89), I113 (≠ L109), S142 (= S136), Y155 (≠ L149), K159 (= K153), P185 (= P179), I188 (= I182), T190 (= T184)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
34% identity, 98% coverage: 2:244/248 of query aligns to 46:290/294 of P0AG84
Sites not aligning to the query:
- 39 modified: N6-acetyllysine
A0A3Q8GL18 (+)-cis,trans-nepetalactol synthase NEPS1; Nepetalactol-related short-chain dehydrogenase; Nepetalactol dehydrogenase; Nepetalactol-related short-chain reductase 1; Nepetalactol-related SDR1; NmNEPS1; EC 5.5.1.34; EC 1.1.1.419 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
33% identity, 98% coverage: 2:245/248 of query aligns to 14:262/271 of A0A3Q8GL18
- N125 (≠ V107) mutation to A: Strongly reduced cis-trans-nepetalactone levels.
- T152 (= T134) mutation to N: Absence of cis-trans-nepetalactone.
- T153 (= T135) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T154 (≠ S136) mutation to G: Loss of dehydrogenase activity and strongly enhanced cis-trans-nepetalactol levels associated with a huge increase in Km for cis-trans-nepetalactol.
- P155 (≠ F137) mutation to S: Strongly reduced cis-trans-nepetalactone levels.
- L156 (= L138) mutation to S: Reduced dehydrogenase activity and absence of cis-trans-nepetalactone.
- Y167 (≠ L149) mutation to F: Absence of cis-trans-nepetalactone.
- K171 (= K153) mutation to M: Absence of cis-trans-nepetalactone.
- S198 (≠ G180) mutation to M: Absence of cis-trans-nepetalactone.
- V199 (≠ T181) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T202 (= T184) mutation to A: Absence of cis-trans-nepetalactone.
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
32% identity, 99% coverage: 3:248/248 of query aligns to 11:259/267 of 3ay6B
- active site: G24 (= G16), S151 (= S136), Y164 (≠ L149), K168 (= K153)
- binding beta-D-glucopyranose: E102 (≠ S90), S151 (= S136), H153 (≠ L138), W158 (≠ K143), Y164 (≠ L149), N202 (≠ Y187), K205 (≠ I190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G12), T23 (≠ S15), G24 (= G16), L25 (≠ I17), Y45 (≠ G36), D71 (= D59), V72 (≠ L60), N98 (= N86), A99 (= A87), G100 (= G88), V101 (≠ A89), M149 (≠ T134), S151 (= S136), Y164 (≠ L149), K168 (= K153), P194 (= P179), G195 (= G180), M197 (≠ I182), T199 (= T184), P200 (= P185), I201 (≠ F186), N202 (≠ Y187)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 98% coverage: 3:246/248 of query aligns to 5:259/261 of 6zzsD
- active site: G18 (= G16), S143 (= S136), Y156 (≠ L149)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), I19 (= I17), D38 (≠ G36), M39 (≠ S37), D64 (= D59), V65 (≠ L60), N91 (= N86), A92 (= A87), G93 (= G88), M141 (≠ T134), A142 (≠ T135), S143 (= S136), Y156 (≠ L149), K160 (= K153), P186 (= P179), G187 (= G180), V189 (≠ I182), T191 (= T184), L193 (≠ F186)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ S90), S143 (= S136), N145 (≠ L138), K153 (≠ L146), Y156 (≠ L149), Q197 (vs. gap)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
35% identity, 98% coverage: 3:246/248 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G16), S142 (= S136), Y155 (≠ L149)
- binding acetoacetic acid: Q94 (≠ S90), S142 (= S136), K152 (≠ L146), Y155 (≠ L149), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), I18 (= I17), D37 (≠ G36), M38 (≠ S37), D63 (= D59), V64 (≠ L60), N90 (= N86), A91 (= A87), G92 (= G88), M140 (≠ T134), A141 (≠ T135), S142 (= S136), Y155 (≠ L149), K159 (= K153), Y187 (≠ T181), V188 (≠ I182), T190 (= T184)
7wbcA Hydroxysteroid dehydrogenase wild-type complexed with NAD+ and (4s)-2- 2-methyl-2,4-pentanediol
37% identity, 98% coverage: 1:244/248 of query aligns to 1:245/250 of 7wbcA
- binding calcium ion: Y115 (≠ A112), P116 (≠ G113), H119 (≠ F116)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G16 (= G16), I17 (= I17), D36 (≠ G36), V37 (≠ S37), A61 (= A58), D62 (= D59), I63 (≠ L60), N89 (= N86), F138 (≠ T134), S140 (= S136), Y153 (≠ L149), K157 (= K153), P183 (= P185), F184 (= F186), A185 (≠ Y187), T187 (≠ K189), G189 (= G191), V190 (≠ L192)
Query Sequence
>N515DRAFT_2399 FitnessBrowser__Dyella79:N515DRAFT_2399
MKLKNKVAFITGGTSGIGLETAKLFRAEGAQVVIVGSNAERLAEAGKELGGEVLLVSADL
RKVEDIEHAVEQARAAFGRIDIVFANAGASTVAPLEAITPAYVEENVALNFAGVLFTIQK
TAPLVPKGGSIIVTTSFLNTVGKPGLSVLAATKAAARSLVRTLGAELAPRGIRVNAVSPG
TIATPFYSKIGLTDAQLTEVAAALTEQVGLKRFGDPAEVAKAVLFLASNDSSYTTGVELV
VDGGLTQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory