Comparing N515DRAFT_2412 FitnessBrowser__Dyella79:N515DRAFT_2412 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
56% identity, 92% coverage: 27:319/319 of query aligns to 1:292/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
56% identity, 91% coverage: 29:319/319 of query aligns to 2:291/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
56% identity, 91% coverage: 29:319/319 of query aligns to 2:291/304 of 6hbmA
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
55% identity, 91% coverage: 29:318/319 of query aligns to 1:289/302 of 5ocpA
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
52% identity, 91% coverage: 29:318/319 of query aligns to 24:314/318 of P39325
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
52% identity, 91% coverage: 29:318/319 of query aligns to 2:292/296 of 2vk2A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
35% identity, 79% coverage: 58:309/319 of query aligns to 30:272/274 of 2ioyA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
34% identity, 78% coverage: 61:309/319 of query aligns to 41:278/284 of 7e7mC
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
30% identity, 88% coverage: 31:310/319 of query aligns to 4:276/301 of 2x7xA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
34% identity, 71% coverage: 58:282/319 of query aligns to 31:253/292 of 2fn8A
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
29% identity, 77% coverage: 27:271/319 of query aligns to 5:241/287 of 4yo7A
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
30% identity, 78% coverage: 58:307/319 of query aligns to 32:270/270 of 4zjpA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
30% identity, 77% coverage: 58:302/319 of query aligns to 31:271/271 of 1dbpA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 80% coverage: 59:314/319 of query aligns to 64:311/349 of A0QYB5
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
30% identity, 80% coverage: 59:314/319 of query aligns to 32:279/315 of 4rsmA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 68% coverage: 56:273/319 of query aligns to 61:275/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
30% identity, 69% coverage: 56:274/319 of query aligns to 28:243/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
30% identity, 69% coverage: 56:274/319 of query aligns to 28:243/315 of 4rs3A
Sites not aligning to the query:
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
28% identity, 72% coverage: 58:286/319 of query aligns to 38:260/296 of 4irxA
Sites not aligning to the query:
8fxuA Thermoanaerobacter thermosaccharolyticum periplasmic glucose-binding protein glucose complex: badan conjugate attached at f17c (see paper)
28% identity, 66% coverage: 61:271/319 of query aligns to 35:255/310 of 8fxuA
Sites not aligning to the query:
>N515DRAFT_2412 FitnessBrowser__Dyella79:N515DRAFT_2412
MKNACVLLAMLAIALAGCSRDAGKQVGQVTVGFSQVGAESEWRTANTASVKSALVAPGFD
LKFSDAQQKQENQIKALRSFIAQRVDVIAFSPVVESGWEPVLREAKAAGIPVVLTDRAVK
VSDASLYASLIGSDFIEEGRKAGRWLLQDSTGKPGPIRVVELQGTVGSAPAIDRMKGFHE
VIDTDPRFKLVRSQSGDFTRAKGKEVMEAFLKAEGGHIDVLFAHNDDMAIGAIQAIEEAG
LTPGKDIRIVSIDGVRGAFEAMKAGKLNATIECNPLFGAQLAQLIRDVHAGKPVPKRIVV
EEGVFTQDQAAAALPGRKY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory