Comparing N515DRAFT_2427 FitnessBrowser__Dyella79:N515DRAFT_2427 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
39% identity, 20% coverage: 144:247/527 of query aligns to 58:164/374 of 3dtyA
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
37% identity, 19% coverage: 147:247/527 of query aligns to 65:168/379 of 7d5nA
Sites not aligning to the query:
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
37% identity, 19% coverage: 147:247/527 of query aligns to 65:168/389 of 7d5nB
Sites not aligning to the query:
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
37% identity, 19% coverage: 147:247/527 of query aligns to 66:169/389 of 7d5mA
Sites not aligning to the query:
6t2bB Glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and NAD+.
27% identity, 35% coverage: 60:243/527 of query aligns to 29:185/439 of 6t2bB
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
28% identity, 37% coverage: 156:350/527 of query aligns to 59:257/342 of 7x2yA
Sites not aligning to the query:
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
23% identity, 30% coverage: 99:255/527 of query aligns to 1:161/342 of 3ceaA
Sites not aligning to the query:
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
30% identity, 18% coverage: 156:251/527 of query aligns to 65:159/379 of 6z3cAAA
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
24% identity, 34% coverage: 70:247/527 of query aligns to 8:152/336 of 3ec7A
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
29% identity, 20% coverage: 151:255/527 of query aligns to 56:159/340 of 4n54A
Sites not aligning to the query:
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
34% identity, 19% coverage: 142:243/527 of query aligns to 55:154/390 of F0M433
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
34% identity, 19% coverage: 142:243/527 of query aligns to 53:152/378 of 6a3jC
Sites not aligning to the query:
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
34% identity, 21% coverage: 139:247/527 of query aligns to 48:152/366 of 5yaqB
Sites not aligning to the query:
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
34% identity, 21% coverage: 139:247/527 of query aligns to 48:152/366 of 5ya8A
Sites not aligning to the query:
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
34% identity, 21% coverage: 139:247/527 of query aligns to 49:153/368 of 6ktkC
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
34% identity, 19% coverage: 142:243/527 of query aligns to 54:153/372 of 6a3iA
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
28% identity, 21% coverage: 146:257/527 of query aligns to 46:157/344 of 7xr9A
Sites not aligning to the query:
7xreC Crystal structure of dgpa
28% identity, 20% coverage: 151:257/527 of query aligns to 61:167/363 of 7xreC
Sites not aligning to the query:
5b3vA Crystal structure of biliverdin reductase in complex with biliverdin and NADP+ from synechocystis sp. Pcc 6803 (see paper)
42% identity, 10% coverage: 161:215/527 of query aligns to 63:117/317 of 5b3vA
Sites not aligning to the query:
5b3uB Crystal structure of biliverdin reductase in complex with NADP+ from synechocystis sp. Pcc 6803 (see paper)
42% identity, 10% coverage: 161:215/527 of query aligns to 64:118/317 of 5b3uB
Sites not aligning to the query:
>N515DRAFT_2427 FitnessBrowser__Dyella79:N515DRAFT_2427
MTEESKITKEQQDQQVGGASGNTEARGRISRREFLTGTAIAAAGLMIVPRHVLGGPGHTP
PSDRLNIAGIGVGGMGLHNMRALAGENIVALCDVDWGYTEKSFRGMVDGLPKTQARLDKA
QTAKERRELQEEIAQTKLLSGKFNSARRHTDYRRMLEQQKDIDAVVIATPDHLHAVIASA
AMSHGKHVYLQKPLTWSIYEARELSRKAQDHPKLVTQMGNQGHSTDDARLINEYIAAGAI
GEVREVHAWTNRPLAFWPQGIPRPQARPRPDDASWSEDAVMDRLANAMAGNYPKPEGLVW
DLFLGPGPVVDYHPVYHPFNWRGWVDWGVGAIGDMGAHLIDSPFWSLDLGFPTAVETVST
PFNEASYPMATMTHYEFPARGSRPPVKLTWYDGALLPPRPKGLGAGQISKDGGVLYVGDK
GELIHETYGANPRLLPQSLHDAVGTPPQRYARIKTSHEMNWVDACKGRAEASSPFSYAAR
LTEVMLLGVVSLRAGGRIEYDAENMRITNMPDANAFLRREYRDGWAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory