SitesBLAST
Comparing N515DRAFT_2456 FitnessBrowser__Dyella79:N515DRAFT_2456 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P38502 Acetate kinase; Acetokinase; EC 2.7.2.1 from Methanosarcina thermophila (see 5 papers)
39% identity, 98% coverage: 5:395/401 of query aligns to 3:407/408 of P38502
- N7 (= N9) mutation to A: Almost abolishes catalytic activity. Requires increased magnesium levels for activity. Strongly decreases affinity for acetate.; mutation to D: Almost abolishes catalytic activity. Strongly decreases affinity for acetate.
- S10 (= S12) mutation S->A,T: Strongly decreases catalytic activity. Strongly decreases affinity for acetate.
- S12 (= S14) mutation to A: Decreases catalytic activity. Strongly decreases affinity for acetate. Requires increased magnesium levels for enzyme activity.; mutation to T: Decreases catalytic activity. Strongly decreases affinity for acetate.
- K14 (= K16) mutation to A: Strongly decreases enzyme activity.; mutation to R: Reduces enzyme activity.
- R91 (= R92) mutation R->A,L: Decreases catalytic activity. Decreases affinity for acetate.
- V93 (= V94) mutation to A: Decreases affinity for acetate.
- L122 (= L123) mutation to A: Decreases affinity for acetate.
- D148 (= D149) active site, Proton donor/acceptor; mutation D->A,E,N: Abolishes catalytic activity. Decreases affinity for acetate, but not for ATP.
- F179 (= F179) mutation to A: Decreases affinity for acetate.
- N211 (= N210) mutation to A: Slightly reduced enzyme activity.
- P232 (≠ A231) mutation to A: Decreases affinity for acetate.
- R241 (= R240) mutation R->K,L: Decreases catalytic activity. Strongly reduced affinity for ATP.
- E384 (= E378) mutation to A: Almost abolishes catalytic activity. Strongly decreases affinity for acetate. Requires strongly increased magnesium levels for enzyme activity.
1tuuA Acetate kinase crystallized with atpgs (see paper)
38% identity, 97% coverage: 5:393/401 of query aligns to 3:399/399 of 1tuuA
- active site: N7 (= N9), R91 (= R92), H180 (= H180), R241 (= R240), E384 (= E378)
- binding adenosine-5'-diphosphate: K14 (= K16), G210 (= G209), D283 (= D282), F284 (≠ M283), R285 (= R284), G331 (= G327), I332 (= I328), N335 (≠ H331)
- binding sulfate ion: R91 (= R92), H180 (= H180), G212 (= G211)
1tuuB Acetate kinase crystallized with atpgs (see paper)
38% identity, 97% coverage: 5:392/401 of query aligns to 3:398/398 of 1tuuB
- active site: N7 (= N9), R91 (= R92), H180 (= H180), R241 (= R240), E384 (= E378)
- binding adenosine monophosphate: D283 (= D282), R285 (= R284), G331 (= G327), I332 (= I328), N335 (≠ H331), S336 (≠ A332)
- binding trihydrogen thiodiphosphate: H180 (= H180), G212 (= G211), R241 (= R240)
7fj9A Kpacka (pduw) with amppnp complex structure
41% identity, 98% coverage: 5:395/401 of query aligns to 4:394/395 of 7fj9A
7fj8A Kpacka (pduw) with amp complex structure
41% identity, 98% coverage: 5:395/401 of query aligns to 4:394/395 of 7fj8A
4fwsA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with ctp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwsA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding cytidine-5'-triphosphate: G202 (= G209), N203 (= N210), G204 (= G211), D275 (= D282), L276 (≠ M283), R277 (= R284), G323 (= G327), I324 (= I328), N327 (≠ H331)
- binding 1,2-ethanediol: V21 (≠ L24), C24 (≠ Q27), H115 (= H124), N203 (= N210), T232 (≠ S239), R233 (= R240), K262 (≠ Q269)
4fwrA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwrA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding cytidine-5'-monophosphate: G202 (= G209), N203 (= N210), D275 (= D282), L276 (≠ M283), R277 (= R284), G323 (= G327), I324 (= I328), N327 (≠ H331)
4fwqA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gtp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwqA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding guanosine-5'-triphosphate: H172 (= H180), N203 (= N210), G204 (= G211), D275 (= D282), L276 (≠ M283), R277 (= R284), E280 (vs. gap), G323 (= G327), I324 (= I328), N327 (≠ H331)
4fwpA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwpA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding 1,2-ethanediol: S11 (= S12), H115 (= H124), K262 (≠ Q269)
- binding guanosine-5'-diphosphate: N203 (= N210), D275 (= D282), L276 (≠ M283), R277 (= R284), E280 (vs. gap), G323 (= G327), I324 (= I328), N327 (≠ H331), S328 (≠ A332)
4fwoA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gmp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwoA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding guanosine-5'-monophosphate: G202 (= G209), N203 (= N210), D275 (= D282), L276 (≠ M283), R277 (= R284), E280 (vs. gap), G323 (= G327), I324 (= I328), N327 (≠ H331)
- binding 1,2-ethanediol: E100 (≠ P109), N104 (≠ E113)
4fwnA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with adenosine tetraphosphate (ap4) (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwnA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding adenosine-5'-tetraphosphate: H172 (= H180), H200 (= H207), N203 (= N210), G204 (= G211), D275 (= D282), L276 (≠ M283), R277 (= R284), G323 (= G327), I324 (= I328), N327 (≠ H331)
4fwmA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with atp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwmA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding adenosine-5'-triphosphate: H172 (= H180), H200 (= H207), N203 (= N210), G204 (= G211), D275 (= D282), L276 (≠ M283), R277 (= R284), G323 (= G327), I324 (= I328), N327 (≠ H331)
- binding 1,2-ethanediol: H172 (= H180), R233 (= R240)
4fwkA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with amp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 4fwkA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding adenosine monophosphate: G202 (= G209), N203 (= N210), D275 (= D282), L276 (≠ M283), R277 (= R284), G323 (= G327), I324 (= I328), N327 (≠ H331)
- binding 1,2-ethanediol: D103 (≠ Q112), N104 (≠ E113), R107 (= R116)
2e1zA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a) obtained after co- crystallization with atp (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 2e1zA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding bis(adenosine)-5'-tetraphosphate: N8 (= N9), R83 (= R92), H115 (= H124), G202 (= G209), N203 (= N210), G204 (= G211), P224 (≠ A231), R233 (= R240), D275 (= D282), L276 (≠ M283), R277 (= R284), G323 (= G327), I324 (= I328), N327 (≠ H331)
1x3nA Crystal structure of amppnp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 1x3nA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G209), N203 (= N210), G204 (= G211), D275 (= D282), L276 (≠ M283), R277 (= R284), G323 (= G327), I324 (= I328), N327 (≠ H331)
1x3mA Crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
38% identity, 96% coverage: 4:386/401 of query aligns to 3:386/394 of 1x3mA
- active site: N8 (= N9), R83 (= R92), H172 (= H180), R233 (= R240), E378 (= E378)
- binding adenosine-5'-diphosphate: G202 (= G209), N203 (= N210), D275 (= D282), L276 (≠ M283), R277 (= R284), G322 (≠ A326), G323 (= G327), I324 (= I328), N327 (≠ H331)
4ijnA Crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate (see paper)
38% identity, 96% coverage: 5:389/401 of query aligns to 4:376/376 of 4ijnA
- active site: N8 (= N9), R72 (= R92), H161 (= H180), R222 (= R240), E365 (= E378)
- binding adenosine monophosphate: G191 (= G209), N192 (= N210), D263 (≠ A281), F264 (vs. gap), R265 (vs. gap), G311 (= G327), V312 (≠ I328), N315 (≠ H331), V316 (≠ A332)
4iz9A Crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese (see paper)
38% identity, 96% coverage: 5:390/401 of query aligns to 6:379/381 of 4iz9A
- active site: N10 (= N9), R74 (= R92), H163 (= H180), R224 (= R240), E367 (= E378)
- binding diphosphomethylphosphonic acid adenosyl ester: K17 (= K16), G193 (= G209), N194 (= N210), D265 (≠ A281), F266 (vs. gap), R267 (vs. gap), G313 (= G327), I314 (= I328), N317 (≠ H331), D318 (≠ A332)
1sazA Membership in the askha superfamily: enzymological properties and crystal structure of butyrate kinase 2 from thermotoga maritima (see paper)
23% identity, 43% coverage: 175:346/401 of query aligns to 149:323/375 of 1sazA
- active site: R214 (= R240)
- binding phosphomethylphosphonic acid adenylate ester: H154 (= H180), G184 (= G209), G185 (≠ N210), G186 (= G211), S254 (= S277), D255 (≠ G278), A256 (≠ I279), R257 (≠ S280), G304 (= G327), L305 (≠ I328), H307 (≠ E330)
Query Sequence
>N515DRAFT_2456 FitnessBrowser__Dyella79:N515DRAFT_2456
MNGIILALNAGSSSIKFALHEHRLAAQRLILRGAIEGIGAEPRFTAWQPDGAIIDREAWA
DAAAPHEQLLQPLLAWITARLGAAELAVVGHRVVHGGPSFGQPVRIDTPVMQELERLVSL
APLHQPHPLAAARAIARLRPGLMQVACFDTAFHRGMPAVAASLGLPRAYADDGMRRYGFH
GLSYEYLAGRLREFAPELADGRVIMAHLGNGASLCAMRHGRSIDTTMGFSALDGLVMGSR
CGSLDPGAVLHLLQARGLSVAAIEHLLYQESGLLGVSGISADMRALLASDSGHAREAIEL
FVYRIVKEIGALTSVAGGLDALVFSAGIGEHAASIRSAVCRALAWLGVECDESANGLHKM
LISTAHSAVRVFVIRTDEEAVIAAHAAGVLRASCPPQAAAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory