Comparing N515DRAFT_2463 FitnessBrowser__Dyella79:N515DRAFT_2463 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 98% coverage: 4:290/293 of query aligns to 2:284/284 of Q58761
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
26% identity, 98% coverage: 4:290/293 of query aligns to 2:274/274 of 1u9zA
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 90% coverage: 27:290/293 of query aligns to 25:291/291 of Q97Z86
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
31% identity, 88% coverage: 34:290/293 of query aligns to 32:278/278 of 4twbA
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
27% identity, 80% coverage: 25:259/293 of query aligns to 16:253/287 of 3mbiA
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
27% identity, 80% coverage: 25:259/293 of query aligns to 14:251/286 of Q97CA5
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
27% identity, 80% coverage: 25:259/293 of query aligns to 14:251/285 of 3mbiD
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
27% identity, 80% coverage: 25:259/293 of query aligns to 14:251/284 of 3lpnA
Sites not aligning to the query:
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
25% identity, 92% coverage: 5:274/293 of query aligns to 5:275/308 of 4s2uA
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
25% identity, 92% coverage: 5:274/293 of query aligns to 6:276/315 of P0A717
Sites not aligning to the query:
6asvC E. Coli prpp synthetase (see paper)
25% identity, 92% coverage: 5:274/293 of query aligns to 4:274/311 of 6asvC
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
26% identity, 92% coverage: 5:274/293 of query aligns to 4:268/307 of 7xmvA
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
26% identity, 92% coverage: 5:274/293 of query aligns to 4:268/307 of 7xmuA
P14193 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PPRibP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Bacillus subtilis (strain 168) (see 4 papers)
24% identity, 92% coverage: 5:273/293 of query aligns to 12:279/317 of P14193
Sites not aligning to the query:
1dkuA Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. (see paper)
23% identity, 94% coverage: 5:279/293 of query aligns to 4:268/295 of 1dkuA
Sites not aligning to the query:
1ibsA Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
24% identity, 92% coverage: 5:273/293 of query aligns to 4:260/297 of 1ibsA
1ibsB Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
24% identity, 92% coverage: 5:273/293 of query aligns to 6:262/299 of 1ibsB
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
24% identity, 98% coverage: 5:290/293 of query aligns to 4:292/305 of 2hcrA
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
24% identity, 92% coverage: 4:274/293 of query aligns to 4:274/312 of 7pn0A
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
24% identity, 92% coverage: 4:274/293 of query aligns to 3:273/307 of 5t3oA
>N515DRAFT_2463 FitnessBrowser__Dyella79:N515DRAFT_2463
MRHVVYAMPGNQELADALAHRRRMARLALELHRFPDGEGLVRVEEPPVGAEAIIVCTLDR
PDEKTLPLLMAADTLRELGAGSVGLVAPYLAYLRQDARFRPGEAVSSGIFGRLLAEHFDW
QVTIDPHLHRLRSLTEAGMPQGRAISAAPALAGWLRERVELPLLIGPDEESAPWVESVAA
LMSAPAVVATKRRFGDRKVQVQLPDLSNWPGHNPVLLDDIISSGHTLLKSIEGLRALGMP
APWCVAVHGLFADNALERLRVAGVAGVVTTNSVPGETARIDLSELLAAALPEH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory