SitesBLAST
Comparing N515DRAFT_2514 FitnessBrowser__Dyella79:N515DRAFT_2514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 88% coverage: 21:261/273 of query aligns to 15:252/265 of P07821
- K50 (= K56) mutation to Q: Lack of activity.
- D172 (= D182) mutation to E: Lack of activity.
- E173 (= E183) mutation to A: Lack of activity.
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
39% identity, 78% coverage: 43:256/273 of query aligns to 25:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
39% identity, 78% coverage: 43:256/273 of query aligns to 25:231/248 of 4fi3C
- binding phosphoaminophosphonic acid-adenylate ester: N34 (= N52), G35 (= G53), G37 (= G55), K38 (= K56), S39 (= S57), T40 (≠ S58), R121 (= R147), Q125 (≠ E151), S127 (= S153), G129 (= G155), E130 (= E156), Q158 (≠ E183)
- binding magnesium ion: S39 (= S57), Q79 (= Q98)
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 83% coverage: 20:245/273 of query aligns to 4:224/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y27), V16 (= V32), S36 (≠ N52), G37 (= G53), S38 (≠ A54), G39 (= G55), K40 (= K56), S41 (= S57), T42 (≠ S58), E162 (= E183), H194 (= H215)
- binding magnesium ion: S41 (= S57), E162 (= E183)
Q9JI39 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein from Mus musculus (Mouse) (see 2 papers)
31% identity, 85% coverage: 18:248/273 of query aligns to 457:687/715 of Q9JI39
- G497 (= G55) mutation to A: Decreases ATP binding about 50%.
- K498 (= K56) mutation to R: Decreases ATP binding about 50%.
- C547 (≠ G105) modified: S-glutathionyl cysteine; mutation to A: Does not affect ABCB10 glutathionylation.
- G602 (= G155) mutation to D: Affects ATP hydrolysis but not binding.; mutation to V: Affects ATP hydrolysis but not binding.
- E624 (= E183) mutation to Q: Affects ATP hydrolysis but not binding.
- C675 (≠ V236) mutation to A: Prevents ABCB10 glutathionylation.
Sites not aligning to the query:
- 1:82 modified: transit peptide, Mitochondrion
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 83% coverage: 28:253/273 of query aligns to 16:237/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: V18 (≠ R30), A20 (≠ V32), N40 (= N52), G41 (= G53), G43 (= G55), K44 (= K56), S45 (= S57), T46 (≠ S58), Q88 (= Q98), H139 (≠ L150), M140 (≠ E151), L141 (= L152), S142 (= S153), G144 (= G155), Q145 (≠ E156), Q166 (≠ E183), H198 (= H215)
- binding magnesium ion: S45 (= S57), Q88 (= Q98)
Sites not aligning to the query:
4ayxA Structure of the human mitochondrial abc transporter, abcb10 (rod form b) (see paper)
31% identity, 85% coverage: 18:248/273 of query aligns to 339:569/571 of 4ayxA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 85% coverage: 18:248/273 of query aligns to 3:227/241 of 4u00A
7y48B Cryo-em structure of biliverdin-bound mitochondrial abc transporter abcb10 from biortus
30% identity, 85% coverage: 18:248/273 of query aligns to 338:565/567 of 7y48B
Sites not aligning to the query:
Q9NRK6 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2 from Homo sapiens (Human) (see 5 papers)
31% identity, 85% coverage: 18:248/273 of query aligns to 492:722/738 of Q9NRK6
- K533 (= K56) mutation to E: Increases hemoglobin biosynthetic process.
- D545 (≠ Q68) to N: in dbSNP:rs35698797
- C582 (≠ G105) mutation to G: Does not affect ATPase activity; when associated with S-215 and L-224. Activated by Zn (II) mesoporphyrin; when associated with S-215 and L-224.
- S635 (= S153) mutation to R: Does not rescue hemoglobin and heme biosynthetic process.
- Q638 (≠ E156) mutation to H: Does not rescue hemoglobin and heme biosynthetic process.
- D658 (= D182) mutation to A: Does not rescue hemoglobin and heme biosynthetic process.
- E659 (= E183) mutation to A: Does not rescue hemoglobin and heme biosynthetic process.
Sites not aligning to the query:
- 150 A → S: in dbSNP:rs4148756
- 215 C→S: Does not affect ATPase activity; when associated with L-224 and G-582. Activated by Zn (II) mesoporphyrin; when associated with L-224 and G-582.
- 224 C→L: Does not affect ATPase activity; when associated withS-215 and G-582. Activated by Zn (II) mesoporphyrin; when associated with S-215 and G-582.
- 471 R → T: in a breast cancer sample; somatic mutation
3nhaA Nucleotide binding domain of human abcb6 (adp mg bound structure) (see paper)
31% identity, 84% coverage: 18:245/273 of query aligns to 41:262/278 of 3nhaA
5l22B Prtd t1ss abc transporter (see paper)
30% identity, 80% coverage: 28:245/273 of query aligns to 325:536/540 of 5l22B
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
25% identity, 87% coverage: 18:254/273 of query aligns to 3:233/240 of 6mjpA
Q00748 Multidrug resistance protein homolog 65; P-glycoprotein 65; EC 7.6.2.2 from Drosophila melanogaster (Fruit fly) (see paper)
29% identity, 89% coverage: 3:245/273 of query aligns to 390:629/1302 of Q00748
Sites not aligning to the query:
- 103 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
28% identity, 84% coverage: 29:257/273 of query aligns to 19:247/280 of Q5M244
- Q97 (≠ A112) mutation to A: No effect on ATPase, 10-fold decrease in riboflavin uptake; when associated with A-90 in EcfA1.
- E171 (= E183) mutation to Q: 10-fold decrease in ATPase and riboflavin uptake; when associated with Q-163 in EcfA1.
3nh9A Nucleotide binding domain of human abcb6 (atp bound structure) (see paper)
31% identity, 84% coverage: 18:245/273 of query aligns to 35:257/273 of 3nh9A
P21439 Phosphatidylcholine translocator ABCB4; ATP-binding cassette sub-family B member 4; Multidrug resistance protein 3; P-glycoprotein 3; EC 7.6.2.1 from Homo sapiens (Human) (see 22 papers)
29% identity, 84% coverage: 18:245/273 of query aligns to 394:618/1286 of P21439
- Y403 (= Y27) to H: in PFIC3; does not alter cytoplasmic and cell membrane location; inhibits efflux activity for PC and cholesterol; dbSNP:rs121918443
- R406 (= R30) binding ; to Q: found in patients with cholangitis; uncertain significance; dbSNP:rs763807769
- GCGKST 432:437 (≠ GAGKSS 53:58) binding
- K435 (= K56) mutation to M: Inhibits efflux activity for PC and cholesterol, but does not alter glycosylation and surface expression in the presence of taurocholate.
- E450 (≠ V71) to G: in dbSNP:rs1189003716
- D459 (≠ A80) to H: in PFIC3; retained in the reticulum endoplasmic; greatly reduced expression
- Q477 (= Q98) binding
- P479 (≠ V100) to L: in PFIC3; greatly reduced expression; alters efflux activity for PC; dbSNP:rs748657435
- L481 (= L102) to R: in PFIC3; does not alter cytoplasmic and cell membrane location; inhibits efflux activity for PC and cholesterol
- A511 (= A141) to T: in PFIC3 and GBD1; dbSNP:rs1257887155
- E528 (≠ R147) to D: in GBD1; uncertain significance; moderate decrease of phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs8187797
- G535 (= G154) to D: in PFIC3; reduced phosphatidylcholine transporter activity; does not alter plasma membrane location
- G536 (= G155) binding ; to R: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location
- I541 (≠ V160) to F: in PFIC3 and GBD1; dbSNP:rs66904256
- A546 (≠ V165) to D: in ICP3; disruption of protein trafficking with subsequent lack of functional protein at the cell surface; dbSNP:rs121918441
- E558 (= E183) mutation to Q: Loss of floppase activity. Strongly reduce the ATPase activity.
- H589 (= H215) to T: in GBD1; requires 2 nucleotide substitutions
- R590 (≠ D216) to Q: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs45575636
Sites not aligning to the query:
- 34 modified: Phosphothreonine; T → M: in GBD1; reduces efflux activity for PC in a phosphorylation-dependent manner; dbSNP:rs142794414; T→D: Does not inhibit efflux activity for PC.
- 44 T→A: Reduces efflux activity for PC. Does not alter apical membrane location.
- 47 R → G: in GBD1; partly retained intracellularly; reduces efflux activity for PC in a phosphorylation-dependent manner; R → Q: found in patients with cholangitis; uncertain significance; dbSNP:rs372685632
- 49 S→A: Reduces efflux activity for PC. Does not alter apical membrane location.
- 68 G → R: in PFIC3; retained in the reticulum endoplasmic; greatly reduced expression; dbSNP:rs1343667900
- 73 L → V: in PFIC3 and GBD1; dbSNP:rs8187788
- 87 natural variant: D -> E
- 95 P → S: in dbSNP:rs377268767
- 175 T → A: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs58238559
- 201 T → M: in PFIC3; greatly reduced expression; alters efflux activity for PC; dbSNP:rs753318087
- 238 L → V: in dbSNP:rs45596335
- 263 I → V: in dbSNP:rs45547936
- 286 A → V: in PFIC3 and GBD1; does not alter plasma membrane location; inhibits efflux activity for PC; dbSNP:rs765478923
- 320 S → F: in ICP3, GBD1 and PFIC3; uncertain significance; does not alter plasma membrane location; does not inhibit efflux activity for PC; dbSNP:rs72552778
- 367 I → V: in dbSNP:rs1168923653
- 651 T → N: in dbSNP:rs45476795
- 652 R → G: in dbSNP:rs2230028
- 726 P → L: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs141677867
- 742 natural variant: G -> S
- 764 I → L: in a heterozygous patient with risperidone-induced cholestasis
- 775 T → M: found in patients with cholangitis; uncertain significance; dbSNP:rs148052192
- 788 R → Q: in GBD1; benign; dbSNP:rs8187801
- 934 A → T: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs61730509
- 953 A→D: Accumulates predominantly in intracellular compartments with only a small fraction at the plasma membrane and inhibits partially the efflux activity for PC.
- 964 V → T: found in patients with cholangitis; uncertain significance; requires 2 nucleotide substitutions
- 978 S → P: in PFIC3; alters efflux activity for PC; dbSNP:rs1051861187
- 985 V→M: Significantly reduces phosphatidylcholine floppase activity; when associated with Q-989 and V-990.
- 989 H→Q: Significantly reduces phosphatidylcholine floppase activity; when associated with M-985 and V-990.
- 990 A→V: Significantly reduces phosphatidylcholine floppase activity; when associated with M-985 and Q-989.
- 1046 binding
- 1071:1077 binding
- 1075 K→M: Inhibits efflux activity for PC and cholesterol, but does not alter glycosylation and surface expression in the presence of taurocholate.
- 1082 L → Q: in a heterozygous patient with amoxicillin/clavulanic acid-induced cholestasis; dbSNP:rs1214110864
- 1124 binding
- 1125 E → K: in PFIC3; alters efflux activity for PC
- 1168 P → S: in GBD1; reduced phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs121918442
- 1183 S → L: in GBD1; severely reduced phosphatidylcholine transporter activity; does not alter plasma membrane location
- 1184:1186 binding
- 1185 G → S: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location
8k7bA Post-occluded structure of human abcb6 w546a mutant (adp/vo4-bound) (see paper)
31% identity, 84% coverage: 18:246/273 of query aligns to 353:576/590 of 8k7bA
- binding adp orthovanadate: Y362 (= Y27), G389 (= G53), G391 (= G55), K392 (= K56), S393 (= S57), T394 (≠ S58), K489 (≠ E151), L490 (= L152), S491 (= S153), G492 (= G154), H546 (= H215)
- binding magnesium ion: S393 (= S57), Q434 (= Q98)
7niwA Nanodisc reconstituted human abcb4 in complex with 4b1-fab (posaconazole-bound, inward-open conformation) (see paper)
29% identity, 84% coverage: 18:245/273 of query aligns to 343:567/1140 of 7niwA
Sites not aligning to the query:
- binding cholesterol: 70, 152, 160, 266, 641, 645, 648, 839
- binding 1,2-dilinoleoyl-sn-glycero-3-phosphocholine: 173, 183, 250, 254, 257, 261, 286, 294, 298, 617, 882
- binding posaconazole: 250, 291, 294, 658, 661, 726, 841, 871, 874, 878, 882
7dnyB Cryo-em structure of the human abcb6 (coproporphyrin iii-bound) (see paper)
31% identity, 84% coverage: 18:246/273 of query aligns to 337:560/575 of 7dnyB
Sites not aligning to the query:
- binding coproporphyrin III: 293, 297
- binding cholesterol hemisuccinate: 19, 23, 24, 31, 34, 51, 54, 58, 151, 155
Query Sequence
>N515DRAFT_2514 FitnessBrowser__Dyella79:N515DRAFT_2514
MSLAMDWRALSDGEERWLEARDVHLHYGERRVLQAVNLRAQPGRVLALIGPNGAGKSSLL
GVLAGALQPSVGTATLDGVALERWPATELARRRAMLSQRVQLGFGFRAEEVAMLGRSPHG
ATSSRSADGRIVEEALKAAGAWSLFGRNYLELSGGEQQRVQLARVLAQIWDCRDAPGWLL
LDEPEAGLDIAHQHELLAQARQLAGQGFGVIAVLHDLNLAARYADDVALLAQGRLVRHGG
REQVLDAPMLSKIYGLPLACVRDGDGRPLIHAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory