Comparing N515DRAFT_2687 FitnessBrowser__Dyella79:N515DRAFT_2687 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
33% identity, 36% coverage: 13:303/798 of query aligns to 1:289/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
33% identity, 36% coverage: 13:303/798 of query aligns to 1:289/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
33% identity, 36% coverage: 13:303/798 of query aligns to 1:289/291 of 1f0yA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
33% identity, 36% coverage: 13:303/798 of query aligns to 24:312/314 of Q16836
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
33% identity, 36% coverage: 13:303/798 of query aligns to 24:312/314 of P00348
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 36% coverage: 16:302/798 of query aligns to 5:284/286 of P9WNP7
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
33% identity, 36% coverage: 16:302/798 of query aligns to 2:279/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
33% identity, 36% coverage: 16:302/798 of query aligns to 2:279/283 of 4pzdA
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
29% identity, 36% coverage: 16:302/798 of query aligns to 1:278/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
29% identity, 36% coverage: 16:302/798 of query aligns to 1:278/280 of 4kuhA
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
28% identity, 55% coverage: 3:440/798 of query aligns to 277:692/692 of 6iunB
Sites not aligning to the query:
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
29% identity, 36% coverage: 17:302/798 of query aligns to 1:277/281 of 6aa8E
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
32% identity, 37% coverage: 13:305/798 of query aligns to 330:616/728 of 8oqlA
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
32% identity, 37% coverage: 13:305/798 of query aligns to 313:599/711 of 7o4uA
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
32% identity, 37% coverage: 13:305/798 of query aligns to 330:616/727 of 8oqoA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
32% identity, 37% coverage: 13:305/798 of query aligns to 331:617/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
32% identity, 37% coverage: 13:305/798 of query aligns to 332:618/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
32% identity, 37% coverage: 13:305/798 of query aligns to 331:617/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
32% identity, 37% coverage: 13:305/798 of query aligns to 331:617/729 of 8oqnA
Sites not aligning to the query:
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
32% identity, 37% coverage: 13:305/798 of query aligns to 331:617/729 of 8opvA
Sites not aligning to the query:
>N515DRAFT_2687 FitnessBrowser__Dyella79:N515DRAFT_2687
MTAQIASTPVASKLRIRKAAVLGAGVMGAQIAAHLTNANVETVLFDLPAKEGPKSGIALK
AIENLKKLSPAPLADGSRAAAIIPANYDDDLEHLKDVDLVIEAIAERMDWKLDLYKKIAP
YVAPHAVLASNTSGLSINGLAEALPEEMRHRFTGVHFFNPPRYMHLVELIPTRLTEAKVL
EGLEAFLTTVVGKGVVYAKDTPNFIGNRIGVFSMLATMHHTEQFKLGFDVVDALTGPAVG
RPKSATYRTADVVGLDTMAHVIKTMADTLADDPWHQYFKAPAWLQGLIEQGALGQKTGAG
FYRKAGKDIVVLDVAKRDYRASEQQASDEVAAILAIKDPAEKFAKLRASSDPQAQFLWAT
FRDLFHYTAYHLADIADTARDVDFAIRWGYGWKLGPFETWQAAGWQQVATWIGEDIAAGK
AMSSAPLPKWVTDGRSGVHGKSGSYSASANADKPRSQHPVYRRQLFPDPILGEKFDQGST
VWENDGVRLWTLGDDGVGIISFKTKMNTVNDQVLDGIQQAIDVAEQQLKAVVIWQTGEPF
SAGADLKGALGLLQAGKLGDFEAMVANFQRTSMRIKHSLVPVVSAVRGLALGGGCEFQMH
SARTVAALESYIGLVEAGVGLLPAGGGLHELAIRAAQANPADPFEALKKVFETVAMAKVS
GSALEAKQLGLLRDSDVVVFNAYELLHVAKQVAGALAESGYRPPLPARSIPVAGDVGTAT
FRASLANMQAGYFVSEHDVAIATRIADTLCGGAIERGSQVDEEWLLQLERKHFVELAQTE
KTQARIAHTMTTGKPLRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory