Comparing N515DRAFT_2700 FitnessBrowser__Dyella79:N515DRAFT_2700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
55% identity, 95% coverage: 7:281/291 of query aligns to 7:278/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
54% identity, 95% coverage: 5:280/291 of query aligns to 3:271/282 of 5ve7A
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
52% identity, 97% coverage: 3:285/291 of query aligns to 3:280/288 of 2ux8G
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
49% identity, 99% coverage: 5:291/291 of query aligns to 2:289/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
49% identity, 99% coverage: 5:291/291 of query aligns to 2:289/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
48% identity, 99% coverage: 5:291/291 of query aligns to 2:284/285 of 6ikzB
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
49% identity, 91% coverage: 5:270/291 of query aligns to 8:271/281 of 8f73E
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
43% identity, 91% coverage: 5:270/291 of query aligns to 2:257/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
43% identity, 91% coverage: 5:270/291 of query aligns to 2:257/264 of 3jukD
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
45% identity, 97% coverage: 3:285/291 of query aligns to 3:247/255 of 2ux8A
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
45% identity, 96% coverage: 9:288/291 of query aligns to 6:284/291 of 8b6dA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
43% identity, 96% coverage: 9:288/291 of query aligns to 6:279/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
41% identity, 98% coverage: 5:289/291 of query aligns to 3:291/299 of 2pa4B
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
26% identity, 92% coverage: 6:274/291 of query aligns to 4:241/295 of 6n0uA
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 92% coverage: 6:274/291 of query aligns to 4:241/292 of P26393
1h5sB Thymidylyltransferase complexed with tmp (see paper)
25% identity, 93% coverage: 5:274/291 of query aligns to 3:241/291 of 1h5sB
Sites not aligning to the query:
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
25% identity, 93% coverage: 5:274/291 of query aligns to 2:240/290 of 1h5tA
Sites not aligning to the query:
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
25% identity, 93% coverage: 5:274/291 of query aligns to 2:240/290 of 1h5rA
Sites not aligning to the query:
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
24% identity, 92% coverage: 6:274/291 of query aligns to 4:241/289 of 1iinA
1iimA Thymidylyltransferase complexed with ttp (see paper)
24% identity, 92% coverage: 6:274/291 of query aligns to 4:241/289 of 1iimA
Sites not aligning to the query:
>N515DRAFT_2700 FitnessBrowser__Dyella79:N515DRAFT_2700
MSKPLRKVVFPVAGLGTRFLPATKVVAKEMLPVLDKPLIQYAVDEAVDAGADTLVFVTNR
YKHAIADYFDKAYELEAKLQEKGKDELLALVQGTLPRNVRAIFVTQPEALGLGHAVLCAK
PVVGDEPFGVILPDDLIWNQGKGALGQMAELAQGQGAGGVIAVEEVPQTDTDKYGIVDAT
PIDPRSAQIRHMVEKPKPSEAPSNLAVVGRYVLPGRIFELLEKTTPGAGGEIQLTDAIDA
LLKEQGKVLAYRFEGTRFDCGNKAGLVRATMHMALQDPKLAPVVRELLAGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory