Comparing N515DRAFT_2935 FitnessBrowser__Dyella79:N515DRAFT_2935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9S5G5 Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 from Escherichia coli O157:H7 (see paper)
55% identity, 100% coverage: 1:354/354 of query aligns to 1:355/355 of Q9S5G5
5el9A A. Thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution (see paper)
48% identity, 54% coverage: 164:354/354 of query aligns to 1:196/199 of 5el9A
O23346 Imidazoleglycerol-phosphate dehydratase 2, chloroplastic; IGPD 2; Protein HISTIDINE BIOSYNTHESIS 5B; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
47% identity, 55% coverage: 162:354/354 of query aligns to 72:269/272 of O23346
5ekwA A. Thaliana igpd2 in complex with the racemate of the triazole- phosphonate inhibitor, c348 (see paper)
48% identity, 53% coverage: 164:352/354 of query aligns to 1:194/194 of 5ekwA
P34047 Imidazoleglycerol-phosphate dehydratase 1, chloroplastic; IGPD 1; Protein HISTIDINE BIOSYNTHESIS 5A; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
47% identity, 53% coverage: 166:354/354 of query aligns to 74:267/270 of P34047
6fwhA Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
47% identity, 53% coverage: 166:354/354 of query aligns to 3:195/196 of 6fwhA
6fwhL Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
47% identity, 53% coverage: 166:354/354 of query aligns to 2:194/195 of 6fwhL
4qnkA The structure of wt a. Thaliana igpd2 in complex with mn2+ and phosphate (see paper)
49% identity, 50% coverage: 164:339/354 of query aligns to 1:178/185 of 4qnkA
4mu1A The structure of wt a. Thaliana igpd2 in complex with mn2+, imidazole, and sulfate at 1.5 a resolution (see paper)
49% identity, 50% coverage: 164:339/354 of query aligns to 1:178/185 of 4mu1A
4mu0A The structure of wt a. Thaliana igpd2 in complex with mn2+ and 1,2,4- triazole at 1.3 a resolution (see paper)
49% identity, 50% coverage: 164:339/354 of query aligns to 1:178/185 of 4mu0A
8qavA Medicago truncatula hisn5 (igpd) in complex with mn and ig2 (see paper)
48% identity, 49% coverage: 166:339/354 of query aligns to 2:177/184 of 8qavA
8qawA Medicago truncatula hisn5 (igpd) in complex with mn, imd, edo, fmt, gol and trs (see paper)
48% identity, 49% coverage: 166:339/354 of query aligns to 3:178/185 of 8qawA
4mu3A The form a structure of an e21q catalytic mutant of a. Thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution (see paper)
48% identity, 50% coverage: 164:339/354 of query aligns to 1:178/186 of 4mu3A
2f1dA X-ray structure of imidazoleglycerol-phosphate dehydratase (see paper)
48% identity, 49% coverage: 166:339/354 of query aligns to 2:177/183 of 2f1dA
2fpsB Crystal structure of the n-terminal domain of e.Coli hisb- apo ca model. (see paper)
53% identity, 45% coverage: 3:161/354 of query aligns to 1:160/163 of 2fpsB
1rhyB Crystal structure of imidazole glycerol phosphate dehydratase (see paper)
46% identity, 51% coverage: 164:342/354 of query aligns to 1:179/180 of 1rhyB
2fprA Crystal structure the n-terminal domain of e. Coli hisb. Apo mg model. (see paper)
53% identity, 45% coverage: 2:161/354 of query aligns to 1:155/156 of 2fprA
2fpuB Crystal structure of the n-terminal domain of e.Coli hisb- complex with histidinol (see paper)
53% identity, 45% coverage: 3:161/354 of query aligns to 1:157/160 of 2fpuB
P06633 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
42% identity, 53% coverage: 166:354/354 of query aligns to 4:219/220 of P06633
6ezmU Imidazoleglycerol-phosphate dehydratase from saccharomyces cerevisiae (see paper)
42% identity, 53% coverage: 166:354/354 of query aligns to 2:212/212 of 6ezmU
>N515DRAFT_2935 FitnessBrowser__Dyella79:N515DRAFT_2935
MSRKLLFVDRDGCLIEEPADEQIDSYEKLALLPGVIAALQRCVAAGYELVMVTNQDGLGT
DSFPEAHFTGPHELLMRILASQGVRFREVLIDRSFPRDGLDTRKPGIGMLRHYLADDGWS
RAASAMVGDRQTDLQFAANMGVRGFLVGPKGLAWEEIAHQLLDAPRTATVTRNTRETRIT
VRVDLDRVAEPKAQTGLGFFDHMLEQIGKHGGFALELECDGDTRIDEHHTIEDCALALGQ
ALRQALGDKRGIARYGFTLPMDESQASAALDLSGRPYFVFEGSFPRERVGDVPTELVPHF
FRSLCETLGANLHLSVYGDNAHHMVEACFKVVARALRQALRREGSELPSTKGAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory