SitesBLAST
Comparing N515DRAFT_2996 FitnessBrowser__Dyella79:N515DRAFT_2996 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 97% coverage: 4:279/286 of query aligns to 15:293/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (≠ A12), M24 (= M13), N43 (= N32), R44 (= R33), T45 (= T34), K48 (= K37), V77 (= V66), S78 (≠ T67), D82 (= D71), Q85 (vs. gap), V133 (= V119), F244 (= F230), K245 (= K231), H248 (≠ L234), K251 (= K237)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 97% coverage: 4:279/286 of query aligns to 15:290/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (≠ A12), M24 (= M13), N43 (= N32), R44 (= R33), T45 (= T34), K48 (= K37), M76 (≠ C65), V77 (= V66), S78 (≠ T67), D82 (= D71), Q85 (vs. gap), V133 (= V119), F241 (= F230), K242 (= K231), H245 (≠ L234), K248 (= K237)
- binding sulfate ion: T134 (≠ S120), G135 (= G121), K183 (= K169)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
39% identity, 98% coverage: 4:284/286 of query aligns to 2:281/288 of 1wp4A
- active site: S116 (= S120), K164 (= K169), N167 (= N172), N168 (≠ Q173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G9), L8 (= L10), G9 (= G11), A10 (= A12), M11 (= M13), N29 (= N32), R30 (= R33), T31 (= T34), K34 (= K37), C61 (= C65), L62 (≠ V66), P63 (≠ T67), E67 (≠ D71), S90 (≠ T94), V115 (= V119), T225 (≠ G229), F226 (= F230), K233 (= K237)
- binding sulfate ion: S116 (= S120), G117 (= G121), G118 (= G122), K164 (= K169)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
39% identity, 98% coverage: 4:284/286 of query aligns to 3:282/289 of 2cvzC
- active site: S117 (= S120), K165 (= K169), N168 (= N172), N169 (≠ Q173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), L9 (= L10), G10 (= G11), A11 (= A12), M12 (= M13), N30 (= N32), R31 (= R33), T32 (= T34), C62 (= C65), L63 (≠ V66), P64 (≠ T67), E68 (≠ D71), E71 (≠ A74), S91 (≠ T94), V116 (= V119), F227 (= F230), K234 (= K237)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
32% identity, 97% coverage: 4:281/286 of query aligns to 3:283/287 of 3pefA
- binding glycerol: D67 (vs. gap), G123 (= G121), K171 (= K169), N175 (≠ Q173), M178 (≠ V176), L203 (= L201), G207 (= G205), N213 (≠ S211), A217 (≠ E215), F232 (= F230), H236 (≠ L234), K239 (= K237), R242 (≠ G240), R269 (≠ M267)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), I11 (≠ A12), M12 (= M13), N31 (= N32), R32 (= R33), S33 (≠ T34), K36 (= K37), M64 (vs. gap), L65 (vs. gap), A66 (vs. gap), A70 (vs. gap), E73 (≠ D71), T96 (= T94), V121 (= V119), G123 (= G121), S124 (≠ G122), A231 (≠ G229), F232 (= F230), H236 (≠ L234), K239 (= K237)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
30% identity, 97% coverage: 4:281/286 of query aligns to 5:287/294 of 5je8B
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
36% identity, 98% coverage: 4:282/286 of query aligns to 2:289/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), H10 (≠ A12), M11 (= M13), F29 (≠ A31), D30 (≠ N32), L31 (≠ R33), M63 (≠ C65), L64 (≠ V66), P65 (≠ T67), T94 (= T94), V119 (= V119), G121 (= G121), F237 (= F230), K244 (= K237)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 98% coverage: 4:282/286 of query aligns to 3:291/298 of Q9I5I6
- P66 (≠ T67) binding
- T96 (= T94) binding ; mutation to A: Almost abolished activity.
- S122 (= S120) mutation to A: Strongly reduced activity.
- K171 (= K169) active site
- N175 (≠ Q173) mutation to A: Strongly reduced activity.
- W214 (= W212) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K237) binding ; mutation to A: Almost abolished activity.
- D247 (= D238) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
36% identity, 98% coverage: 4:282/286 of query aligns to 3:290/295 of 3obbA
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
30% identity, 97% coverage: 7:282/286 of query aligns to 6:284/287 of 3pduA
- binding glycerol: R242 (≠ G240), E246 (≠ R244), E246 (≠ R244), R250 (≠ G248)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), G10 (= G11), I11 (≠ A12), M12 (= M13), N31 (= N32), R32 (= R33), N33 (≠ T34), M64 (≠ V66), L65 (≠ T67), A66 (= A68), A70 (vs. gap), T96 (= T94), V121 (= V119), G123 (= G121), T124 (≠ G122), K171 (= K169), S231 (≠ G229), F232 (= F230), P233 (≠ K231), H236 (≠ L234), K239 (= K237)
7puaFM uS11m (see paper)
32% identity, 78% coverage: 2:224/286 of query aligns to 5:242/327 of 7puaFM
Sites not aligning to the query:
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
32% identity, 98% coverage: 6:286/286 of query aligns to 4:290/292 of 5y8iA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
32% identity, 98% coverage: 6:286/286 of query aligns to 4:290/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (= R146), E148 (= E150), A151 (= A153), K153 (≠ R155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G9 (= G11), N10 (≠ A12), M11 (= M13), F29 (vs. gap), D30 (vs. gap), P31 (vs. gap), M63 (≠ V48), L64 (≠ A49), G120 (= G122), L239 (= L234), K242 (= K237)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
32% identity, 98% coverage: 6:284/286 of query aligns to 5:289/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ K130), E149 (= E150), A152 (= A153), G153 (≠ L154), G153 (≠ L154), K154 (≠ R155)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S120), G120 (= G121), W211 (= W212), F236 (= F230)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G10 (= G11), N11 (≠ A12), M12 (= M13), F30 (vs. gap), D31 (vs. gap), P32 (vs. gap), M64 (≠ V48), L65 (≠ A49), T93 (= T94), G121 (= G122), K168 (= K169), L240 (= L234), K243 (= K237)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
32% identity, 98% coverage: 6:284/286 of query aligns to 5:289/290 of 5y8kA
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
29% identity, 98% coverage: 7:286/286 of query aligns to 5:294/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), N10 (≠ A12), M11 (= M13), Y29 (≠ L27), D30 (≠ H28), V31 (≠ A29), M63 (≠ L64), L64 (≠ C65), P65 (≠ V66), T95 (= T94), V120 (= V119), G122 (= G121), F238 (= F230), K245 (= K237)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
29% identity, 98% coverage: 7:286/286 of query aligns to 44:333/336 of P31937
- LP 103:104 (≠ CV 65:66) binding
- N108 (≠ A70) binding
- T134 (= T94) binding
- K284 (= K237) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
2uyyA Structure of the cytokine-like nuclear factor n-pac
26% identity, 97% coverage: 4:281/286 of query aligns to 8:288/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G11), L16 (≠ A12), M17 (= M13), N36 (= N32), R37 (= R33), T38 (= T34), V70 (= V66), S71 (≠ T67), A75 (= A68), T101 (= T94), F237 (= F230), Y238 (≠ K231), Y241 (≠ L234), K244 (= K237)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
28% identity, 98% coverage: 7:286/286 of query aligns to 43:332/335 of P29266
- D68 (≠ A29) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K169) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q173) mutation to Q: Decrease in activity.
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
28% identity, 97% coverage: 4:281/286 of query aligns to 269:549/553 of Q49A26
- 271:285 (vs. 6:20, 40% identical) binding
- T362 (= T94) binding
- M437 (≠ K169) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ V228) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K237) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Query Sequence
>N515DRAFT_2996 FitnessBrowser__Dyella79:N515DRAFT_2996
MTFKAAFVGLGAMGAPMAGHLKSKGLLHAVANRTQAKADALARELGVVAPPLEQLAAQCE
VIALCVTADADVLATIDTMLPHLKRGAVVVDHSTVAPDTAKRAAARLATAGVDFLDAPVS
GGVEGAKNGKLSVMVGGDAAVLERARPVLEAYALRVTHLGDVGAGQATKAVNQVLVAGIA
QAVCEGLALGEALGLEAERLLPTLGAGAAGSWFLEKRGATMLRDEFSVGFKLALLHKDLG
IVKRIAEGAGTDRTVIEKSLADYAELMSQGYGDDDISALIRLKRKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory