Comparing N515DRAFT_3000 FitnessBrowser__Dyella79:N515DRAFT_3000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
47% identity, 98% coverage: 13:626/629 of query aligns to 5:624/628 of 3nzqA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
45% identity, 98% coverage: 8:626/629 of query aligns to 2:629/629 of 3n2oB
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
45% identity, 98% coverage: 8:626/629 of query aligns to 3:630/630 of 3n2oA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 95% coverage: 2:596/629 of query aligns to 31:625/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
33% identity, 96% coverage: 14:617/629 of query aligns to 4:575/591 of 3nzpB
Sites not aligning to the query:
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
24% identity, 37% coverage: 120:350/629 of query aligns to 41:273/394 of 3c5qA
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
24% identity, 37% coverage: 120:350/629 of query aligns to 43:275/405 of B4XMC6
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
23% identity, 48% coverage: 55:357/629 of query aligns to 25:313/434 of 1tufA
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
23% identity, 48% coverage: 55:357/629 of query aligns to 29:317/438 of Q58497
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
23% identity, 48% coverage: 55:357/629 of query aligns to 25:313/434 of 1twiA
Sites not aligning to the query:
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
26% identity, 45% coverage: 67:351/629 of query aligns to 53:314/458 of 8d5dA
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
26% identity, 40% coverage: 97:350/629 of query aligns to 56:289/418 of 4xg1B
Sites not aligning to the query:
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
26% identity, 45% coverage: 67:351/629 of query aligns to 54:316/461 of 8d5rA
Sites not aligning to the query:
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
26% identity, 45% coverage: 67:351/629 of query aligns to 54:318/461 of 8d88A
Sites not aligning to the query:
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
26% identity, 45% coverage: 67:351/629 of query aligns to 54:318/462 of 8d4iA
Sites not aligning to the query:
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
25% identity, 38% coverage: 117:356/629 of query aligns to 86:319/443 of 5x7mA
Sites not aligning to the query:
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
25% identity, 38% coverage: 117:356/629 of query aligns to 86:319/442 of 5x7nA
Sites not aligning to the query:
2pljA Crystal structure of lysine/ornithine decarboxylase complexed with putrescine from vibrio vulnificus (see paper)
26% identity, 21% coverage: 216:350/629 of query aligns to 151:271/376 of 2pljA
Sites not aligning to the query:
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
26% identity, 39% coverage: 117:360/629 of query aligns to 84:325/446 of 1hkvA
Sites not aligning to the query:
2plkA Crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus (see paper)
27% identity, 21% coverage: 216:350/629 of query aligns to 146:266/370 of 2plkA
Sites not aligning to the query:
>N515DRAFT_3000 FitnessBrowser__Dyella79:N515DRAFT_3000
MSKHWNADAARHTYAVPHWGDGYVDVDARGHIVMRPRGAGGPALSLPEIVERARAEGLRL
PLLVRFPDILADRLARLQGAFAKATAEWNYGGGYTAVYPIKVNQQRGVAGELVAAGEHGF
GLEAGSKPELMAVLAMARPGSIVVCNGYKDREYVRLALIGRKLGLRVHIVIEKLSELDHV
FAEAKALGVEPLLGVRVRLASIGAGKWQNTGGDKGKFGLSPNQVLTLVRRLDEAGLKHTL
KLQHFHMGSQISNVRDIAAGMREATRYYVELIRMGVPLEIVDVGGGLGVDYEGSRSRSHN
SINYSIEQYASTIVQSLAEAVAEEGLAAPHIVTEAGRAMTAHHAVMVVNVTEVEEVPAGA
IPPPREDEPAVLRRLRETYEELDARPALELFHEAQHHLNEGQTLYALGQLALEDRARLDE
MYYAIANAVRVRLLPAERSHRQALDELDEKLVDKYFVNFSVFESVPDIWAIDQIFPIAPI
ARLDEAPTRRGVIVDLTCDSDGRIDHYVDAEGVDVSLPLHAVREGESYRLGIFMVGAYQE
TLGDIHNLFGDTDAVNVRVEGDSYVFAHRRRGDTTDLMLDYVGYDLEALRQSYRERIAAA
GVEGASAEQLFVTLNDGLTGYTYLSEGAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory