Comparing N515DRAFT_3019 FitnessBrowser__Dyella79:N515DRAFT_3019 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
33% identity, 92% coverage: 44:723/737 of query aligns to 2:699/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
33% identity, 92% coverage: 44:723/737 of query aligns to 2:699/715 of 2x42A
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
33% identity, 88% coverage: 82:731/737 of query aligns to 20:645/674 of 5wabA
4i8dB Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
32% identity, 86% coverage: 91:723/737 of query aligns to 51:705/714 of 4i8dB
Sites not aligning to the query:
4i8dA Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
32% identity, 86% coverage: 91:723/737 of query aligns to 48:702/711 of 4i8dA
Sites not aligning to the query:
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
33% identity, 88% coverage: 85:732/737 of query aligns to 41:713/713 of 6jxgA
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
29% identity, 94% coverage: 34:723/737 of query aligns to 4:722/753 of 7zgzX
4iifA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with castanospermine (see paper)
30% identity, 81% coverage: 44:641/737 of query aligns to 25:653/833 of 4iifA
Sites not aligning to the query:
4iigA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with d-glucose (see paper)
30% identity, 81% coverage: 44:641/737 of query aligns to 25:653/834 of 4iigA
Sites not aligning to the query:
4iieA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with calystegine b(2) (see paper)
30% identity, 81% coverage: 44:641/737 of query aligns to 25:653/834 of 4iieA
Sites not aligning to the query:
4iidA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with 1-deoxynojirimycin (see paper)
30% identity, 81% coverage: 44:641/737 of query aligns to 25:653/834 of 4iidA
Sites not aligning to the query:
4iibA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus (see paper)
30% identity, 81% coverage: 44:641/737 of query aligns to 25:653/834 of 4iibA
Sites not aligning to the query:
4iihA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with thiocellobiose (see paper)
30% identity, 80% coverage: 44:631/737 of query aligns to 25:643/833 of 4iihA
Sites not aligning to the query:
4iicA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with isofagomine (see paper)
30% identity, 80% coverage: 44:631/737 of query aligns to 25:643/833 of 4iicA
Sites not aligning to the query:
5ju6A Structural and functional studies of glycoside hydrolase family 3 beta-glucosidase cel3a from the moderately thermophilic fungus rasamsonia emersonii (see paper)
32% identity, 80% coverage: 44:631/737 of query aligns to 26:639/835 of 5ju6A
Sites not aligning to the query:
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
27% identity, 92% coverage: 42:720/737 of query aligns to 4:723/733 of 5tf0A
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
30% identity, 86% coverage: 92:723/737 of query aligns to 76:739/749 of 5xxmA
Sites not aligning to the query:
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
29% identity, 93% coverage: 42:723/737 of query aligns to 3:728/744 of 5xxnA
5yqsA Isoprimeverose-producing enzyme from aspergillus oryzae in complex with isoprimeverose (see paper)
30% identity, 88% coverage: 75:723/737 of query aligns to 68:745/754 of 5yqsA
Sites not aligning to the query:
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
30% identity, 82% coverage: 119:723/737 of query aligns to 91:727/742 of 3u48B
Sites not aligning to the query:
>N515DRAFT_3019 FitnessBrowser__Dyella79:N515DRAFT_3019
MNYKIEGMLRSAVKLGLAAWMCTAIGQVPSARPWSDPKLSPDLRADQLLAQLTQDEKFHL
IRSYFAGPRKPEDKPVPPGYIGSAGYIPALERVGIPAIQESDAGLGVASSERMRPGDYAT
PLPAGPVTAATWDPKVAFRGGAMIGGEAHAKGFNVLLAGGTNLMREPRNGRNFEYAGEDP
LLAGTMVGEAIRGIESQHVVSTIKHFALNDQETARTTVDVRIGEQAMRESDLLAFELAIE
RGKPGSVMCSYNKLNGDWACENDYLLNQVLKRDWKYPGFVMSDWGGVHSAAKAVNAGLDQ
ESAAEIFDKDIYFDKPLRDALAKGEVKQARIDDMVRRILRSFFAAGVFEHPAKKAPIDEK
ANLAVARETLEAGAVLLRNDNQLLPLDVARLESIAVIGAHADKGVLAGGGSSLVTAKGGN
AVPGLKPSDWPGPVMYHPYSPLKALQSMAPKAKVQFTGGDDVAAAAALAAKSQVAVVFVQ
KWAGEDFDARDLSLPDGQDALVTAVAKANPRTIVVLENGSPVAMPWLEQVGAVLEVWYPG
GDAGNGIANLLSGKVNPSGRLPLSWPRDVLQLPRPELPGAGGSGALPQSVDYAIEGANVG
YRWYQSKDLQPLFPFGYGLSYTSFEHGALKVDTKDGKVTATVTVRNTGKRAGADVAQVYV
QVPGAKARRLAGFSKVFLKPGEQRELSIPLERKLLADFDTARHGWVVRGGEYVVSEGRSS
ADLGRPAAVQLSAGVLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory