SitesBLAST
Comparing N515DRAFT_3073 FitnessBrowser__Dyella79:N515DRAFT_3073 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 29% coverage: 74:232/551 of query aligns to 99:260/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
8fvzA Pipt y150a
25% identity, 58% coverage: 17:337/551 of query aligns to 4:327/433 of 8fvzA
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 29% coverage: 73:230/551 of query aligns to 103:267/559 of Q09852
Sites not aligning to the query:
- 297 modified: Phosphoserine
- 299 modified: Phosphoserine
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 29% coverage: 73:231/551 of query aligns to 108:277/572 of O42885
Sites not aligning to the query:
- 12 modified: Phosphoserine
- 14 modified: Phosphoserine
- 292 modified: Phosphoserine
- 296 modified: Phosphoserine
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 36% coverage: 27:225/551 of query aligns to 52:229/444 of Q8NLB7
- D54 (≠ E29) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D32) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ L84) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
24% identity, 44% coverage: 86:327/551 of query aligns to 71:333/437 of 6rw3A
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
30% identity, 17% coverage: 73:168/551 of query aligns to 162:249/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 27% coverage: 74:220/551 of query aligns to 118:277/587 of P25297
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 298 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6m20B Crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose (see paper)
23% identity, 44% coverage: 86:327/551 of query aligns to 81:353/478 of 6m20B
Sites not aligning to the query:
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
29% identity, 17% coverage: 73:168/551 of query aligns to 162:249/556 of Q63089
- C179 (≠ T90) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ L131) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ A132) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L133) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G134) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G135) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ E136) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ Y137) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ G138) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ G139) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ A140) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ A141) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (= T142) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (≠ Y143) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ V144) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (≠ A145) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E146) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ H147) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ A148) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 155 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 286 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- 292 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- 296 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 28% coverage: 70:222/551 of query aligns to 187:325/616 of P36035
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 338 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 46% coverage: 74:325/551 of query aligns to 150:422/592 of P38695
Sites not aligning to the query:
- 61 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 52% coverage: 82:368/551 of query aligns to 92:420/580 of Q9C757
- C399 (≠ A347) mutation to A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; mutation to S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- C402 (≠ T350) mutation to A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- C410 (= C358) mutation to A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; mutation to S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- C413 (≠ Q361) mutation to A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
Q12300 High glucose sensor RGT2; Low-affinity glucose receptor RGT2; Low-affinity transporter-like sensor RGT2; Restores glucose transport protein 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
24% identity, 46% coverage: 73:323/551 of query aligns to 158:432/763 of Q12300
- R231 (= R153) mutation to K: In RGT2-1; constitutively signaling glucose receptor.
Sites not aligning to the query:
- 684:690 SIISDST→AIIADAA: In Rgt2(4SA); Abolishes Yck-dependent phosphorylation, interaction with MTH1 and STD1, and glucose signaling, but does not affect protein stability.
Query Sequence
>N515DRAFT_3073 FitnessBrowser__Dyella79:N515DRAFT_3073
MATTAMGAANIGTGHRRVILASSLGTVFEWYDFYLYGSLAVLIGKHFFSGLNETSAFIFA
LLAFAAGFAVRPFGAIVFGRLGDLVGRKYTFLITIIIMGLSTFLVGVLPSYSTVGMIAPV
LLIVLRLLQGLALGGEYGGAATYVAEHAPDGKRGLYTSFIQITATFGLFLSLLVILGTRM
ALGDKVFEDWGWRIPFLISSVLVAVSVYIRLQLQESPVFQQMKAEGKHSKAPLTEAFGHW
KNLKVVILALLGATAGQAVVWYTGQFYALYFLTQSLKIDGTTANLLIAAALIIGTPFFVF
FGWLSDRIGRKSIVLAGCLLAALTYFPIFKGLTHFGNPAIETAAASAPVTVIADPNACSF
QFDPVGKSKFTSSCDVAKTVLAKKGIPYRNEAAPAGAVAQVTIGTGTIESFEGGGLDSAT
FAAQSKAFGTKIGDALKAAGYPEKADPAQRNDVMLVILLAILVLYVTMVYGPIAAWLVEM
FPTRIRYTSMSLPYHIGNGWFGGFVPTIGFMLVAWKGDIYYGLWYPIIVAVGTFFIGLLF
LKETKDVNITT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory