Comparing N515DRAFT_3133 N515DRAFT_3133 carbohydrate ABC transporter membrane protein 2, CUT1 family (TC 3.A.1.1.-) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
40% identity, 83% coverage: 48:273/273 of query aligns to 55:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
28% identity, 92% coverage: 22:273/273 of query aligns to 28:296/296 of P68183
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
44% identity, 18% coverage: 159:208/273 of query aligns to 378:427/490 of 4ki0F
Sites not aligning to the query:
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
44% identity, 18% coverage: 159:208/273 of query aligns to 393:442/514 of P02916
Sites not aligning to the query:
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
49% identity, 13% coverage: 159:193/273 of query aligns to 200:234/313 of P94529
>N515DRAFT_3133 N515DRAFT_3133 carbohydrate ABC transporter membrane protein 2, CUT1 family (TC 3.A.1.1.-)
MSPRLAKALVNGLLIGSTLVAVFPLLWMLSVSFMRPGEASALPPPLLPTHATLANYHELF
ERAGMGRYLLNSLGVSSAITLLSLAFNLMAGYAFAKLRFSGRERLFQVLLGGLVIPAQVA
MLPLFLLLKYLGLVNSYAAVVVPAMATIFGIFLVRQYARGIPDDLMEAARIDGAGELRIF
VQIVLPLLKPIMVTLAIFTFLTAWNDFMWPLIALTGQEHYTLPIALASLSREHVQDSELM
MAGSVVTVLPVLVLFLALQRYYLQGLLLGSVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory