SitesBLAST
Comparing N515DRAFT_3220 FitnessBrowser__Dyella79:N515DRAFT_3220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
46% identity, 93% coverage: 5:291/309 of query aligns to 2:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N181), T217 (= T209), G219 (= G211), A220 (= A212), G222 (= G214), F250 (= F243), N272 (≠ S265), G275 (≠ S268), A276 (= A269), T279 (≠ C272)
- binding magnesium ion: D242 (= D235), T244 (= T237), A278 (= A271), S287 (≠ G280)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
38% identity, 93% coverage: 5:292/309 of query aligns to 4:303/306 of 4xckA
- active site: A249 (≠ G238), A250 (= A239), G251 (= G240), D252 (= D241)
- binding adenosine-5'-diphosphate: T220 (= T209), G222 (= G211), S223 (≠ A212), V242 (= V231), T247 (= T236), A250 (= A239), F254 (= F243), H276 (≠ S265), A279 (≠ S268), V283 (≠ C272)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G39 (= G40), K40 (= K41), N43 (= N44), A95 (= A96), I107 (= I108), I109 (≠ V110), E140 (= E137), T248 (= T237), D252 (= D241)
6znxC Ribokinase from thermus species
44% identity, 93% coverage: 5:291/309 of query aligns to 2:263/265 of 6znxC
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 93% coverage: 5:291/309 of query aligns to 7:305/309 of P0A9J6
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
40% identity, 93% coverage: 5:291/309 of query aligns to 4:302/305 of 1rk2A
- active site: A249 (≠ G238), A250 (= A239), G251 (= G240), D252 (= D241)
- binding adenosine-5'-diphosphate: T220 (= T209), G222 (= G211), S223 (≠ A212), A250 (= A239), G251 (= G240), H276 (≠ S265), A279 (≠ S268)
- binding tetrafluoroaluminate ion: G213 (≠ D202), R215 (≠ A204)
- binding magnesium ion: D246 (= D235), A282 (= A271), R285 (= R274), S291 (≠ G280)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G38 (= G39), G39 (= G40), K40 (= K41), N43 (= N44), E140 (= E137), D252 (= D241)
1gqtB Activation of ribokinase by monovalent cations (see paper)
40% identity, 93% coverage: 5:291/309 of query aligns to 6:304/307 of 1gqtB
- active site: A251 (≠ G238), A252 (= A239), G253 (= G240), D254 (= D241)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T209), G224 (= G211), S225 (≠ A212), A252 (= A239), G253 (= G240), H278 (≠ S265), A281 (≠ S268)
- binding cesium ion: D248 (= D235), I250 (≠ T237), A284 (= A271), R287 (= R274), S293 (≠ G280)
- binding alpha-D-ribofuranose: N13 (= N12), D15 (= D14), G41 (= G40), N45 (= N44), E142 (= E137), D254 (= D241)
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
35% identity, 93% coverage: 5:291/309 of query aligns to 5:309/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N181), K225 (≠ T209), G227 (= G211), I246 (vs. gap), A248 (= A230), A257 (= A239), G258 (= G240), F261 (= F243), A286 (≠ S268), S287 (≠ A269)
- binding alpha-D-ribofuranose: N12 (= N12), D14 (= D14), G40 (= G40), K41 (= K41), N44 (= N44), E144 (= E137), D259 (= D241)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 93% coverage: 5:291/309 of query aligns to 71:375/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
34% identity, 93% coverage: 6:291/309 of query aligns to 7:320/320 of 6xk2A
6a8cA Ribokinase from leishmania donovani with adp (see paper)
34% identity, 90% coverage: 5:282/309 of query aligns to 16:317/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G211), A246 (= A212), T271 (= T236), A274 (= A239), G275 (= G240), N300 (≠ S265), A303 (≠ S268)
- binding glycerol: D25 (= D14), S42 (≠ G31), S44 (≠ G33), G50 (= G39), G51 (= G40), N55 (= N44)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
34% identity, 90% coverage: 5:282/309 of query aligns to 16:317/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G211), A246 (= A212), T271 (= T236), A274 (= A239), G275 (= G240), N300 (≠ S265), A303 (≠ S268), V307 (≠ C272)
- binding glycerol: D25 (= D14), G50 (= G39), G51 (= G40), N55 (= N44), N157 (≠ L136), I159 (≠ T138), E190 (vs. gap)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
34% identity, 90% coverage: 5:282/309 of query aligns to 16:317/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N181), T243 (= T209), G245 (= G211), A246 (= A212), G248 (= G214), T271 (= T236), G273 (= G238), A274 (= A239), G275 (= G240), N300 (≠ S265), A303 (≠ S268), V307 (≠ C272)
- binding glycerol: D25 (= D14), G50 (= G39), G51 (= G40), N55 (= N44)
6wjzA Crystal structure of human ribokinase in complex with ampcp
32% identity, 90% coverage: 5:282/309 of query aligns to 5:299/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N181), T222 (= T209), G224 (= G211), A225 (= A212), G227 (= G214), T243 (vs. gap), V246 (= V231), A254 (= A239), G255 (= G240), N282 (≠ S265), A285 (≠ S268), A286 (= A269), V289 (≠ C272)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
32% identity, 90% coverage: 5:282/309 of query aligns to 5:299/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T209), G224 (= G211), A225 (= A212), G227 (= G214), T243 (vs. gap), V246 (= V231), A254 (= A239), G255 (= G240), N282 (≠ S265), A285 (≠ S268), A286 (= A269), V289 (≠ C272)
- binding alpha-D-ribofuranose: D14 (= D14), G40 (= G40), K41 (= K41), N44 (= N44), A96 (= A96), E141 (= E137), D256 (= D241)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
32% identity, 90% coverage: 5:282/309 of query aligns to 5:299/317 of 5c41A
- active site: G253 (= G238), A254 (= A239), G255 (= G240), D256 (= D241)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T209), G224 (= G211), A225 (= A212), G227 (= G214), V246 (= V231), G255 (= G240), N282 (≠ S265), A285 (≠ S268), A286 (= A269)
5c3yA Structure of human ribokinase crystallized with amppnp
32% identity, 90% coverage: 5:282/309 of query aligns to 4:298/306 of 5c3yA
- active site: G252 (= G238), A253 (= A239), G254 (= G240), D255 (= D241)
- binding amp phosphoramidate: T221 (= T209), G223 (= G211), V245 (= V231), T250 (= T236), G254 (= G240), N281 (≠ S265), A284 (≠ S268), A285 (= A269)
2fv7A Crystal structure of human ribokinase
32% identity, 90% coverage: 5:282/309 of query aligns to 4:298/308 of 2fv7A
- active site: G252 (= G238), A253 (= A239), G254 (= G240), D255 (= D241)
- binding adenosine-5'-diphosphate: N185 (= N181), T221 (= T209), G223 (= G211), G226 (= G214), T242 (vs. gap), V245 (= V231), A253 (= A239), G254 (= G240), N281 (≠ S265), A284 (≠ S268), A285 (= A269), V288 (≠ C272)
3go6B Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
42% identity, 86% coverage: 5:271/309 of query aligns to 4:264/287 of 3go6B
- active site: G227 (= G238), A228 (= A239), G229 (= G240), D230 (= D241)
- binding adenosine-5'-diphosphate: G200 (= G211), V201 (≠ A212), G203 (= G214), V220 (= V231), T225 (= T236), A228 (= A239), G229 (= G240), C258 (≠ S265), G261 (≠ S268), A262 (= A269)
- binding magnesium ion: D224 (= D235), A226 (≠ T237), A264 (= A271)
Sites not aligning to the query:
3go6A Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
42% identity, 86% coverage: 5:271/309 of query aligns to 4:264/287 of 3go6A
- active site: G227 (= G238), A228 (= A239), G229 (= G240), D230 (= D241)
- binding magnesium ion: D224 (= D235), A264 (= A271)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G39 (= G40), K40 (= K41), N43 (= N44), A94 (= A96), I96 (≠ V98), V106 (≠ I108), E134 (= E137), D230 (= D241)
Sites not aligning to the query:
5byfA Crystal structure of human ribokinase in complex with amp
32% identity, 89% coverage: 9:282/309 of query aligns to 10:300/313 of 5byfA
Query Sequence
>N515DRAFT_3220 FitnessBrowser__Dyella79:N515DRAFT_3220
MKRGVLVAGSANLDFVVRAAHVPAPGETVLGRGFATFPGGKGANQAVACARAGGAPTRML
LALGDDAHAAPIEASLRAAGVGLDAVRMRGESSGVAFVCLADDGENAITVAPGANAALRP
DHLPPLAGVSHLLLQLETPLPTVKAWARVACRAGIHVALNAAPAQALPRSLLDDCQLLIV
NEGELAAITGEHDITAGLDALDVAAVVVTLGARGCCARVGSQYLLQPGFAVDAIDTTGAG
DTFCGVLVAGLSLGLAYPAALRRASAASALACTRLGAQAGVPGYEQVQRLLAVRPADATE
ALAAYVGFA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory