Comparing N515DRAFT_3227 FitnessBrowser__Dyella79:N515DRAFT_3227 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7kncA Crystal structure of the gh31 alpha-xylosidase (xac1773) from xanthomonas citri
59% identity, 95% coverage: 44:954/956 of query aligns to 3:916/919 of 7kncA
2xvlA Crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with pentaerythritol propoxylate (5 4 po oh) (see paper)
55% identity, 96% coverage: 38:955/956 of query aligns to 1:941/944 of 2xvlA
2xvkA Crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with 5-fluoro-alpha-d-xylopyranosyl fluoride (see paper)
55% identity, 96% coverage: 38:955/956 of query aligns to 1:941/944 of 2xvkA
5jovA Bacteroides ovatus xyloglucan pul gh31 with bound 5fidof (see paper)
48% identity, 96% coverage: 37:956/956 of query aligns to 15:949/949 of 5jovA
5zn7A Crystal structure of gh31 alpha-xylosidase from a soil metagenome complexed with xylose
35% identity, 50% coverage: 371:844/956 of query aligns to 199:671/680 of 5zn7A
6jr7A Flavobacterium johnsoniae gh31 dextranase, fjdex31a, complexed with glucose (see paper)
31% identity, 60% coverage: 368:943/956 of query aligns to 194:764/812 of 6jr7A
5x7sA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase, terbium derivative (see paper)
28% identity, 59% coverage: 384:947/956 of query aligns to 212:766/1247 of 5x7sA
Sites not aligning to the query:
5x7qA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase complexed with maltohexaose (see paper)
28% identity, 59% coverage: 384:947/956 of query aligns to 212:766/1247 of 5x7qA
Sites not aligning to the query:
5x7pA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase complexed with acarbose (see paper)
28% identity, 59% coverage: 384:947/956 of query aligns to 212:766/1247 of 5x7pA
Sites not aligning to the query:
5x7oA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase (see paper)
28% identity, 59% coverage: 384:947/956 of query aligns to 212:766/1247 of 5x7oA
Sites not aligning to the query:
7p4dAAA Oligosaccharide 4-alpha-D-glucosyltransferase (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 182:674/780 of 7p4dAAA
Sites not aligning to the query:
7p4cAAA Oligosaccharide 4-alpha-D-glucosyltransferase (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 182:674/780 of 7p4cAAA
Sites not aligning to the query:
5npeA Crystal structure of cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with beta cyclophellitol aziridine probe ky358 (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 182:674/780 of 5npeA
Sites not aligning to the query:
5npbA Crystal structure of cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol cyclosulfate probe me647 (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 182:674/780 of 5npbA
Sites not aligning to the query:
4b9zA Crystal structure of agd31b, alpha-transglucosylase, complexed with acarbose (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 182:674/780 of 4b9zA
Sites not aligning to the query:
4b9yA Crystal structure of apo agd31b, alpha-transglucosylase in glycoside hydrolase family 31 (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 182:674/780 of 4b9yA
Sites not aligning to the query:
5i24A Crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf021 (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 181:673/779 of 5i24A
5i23A Crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf022 (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 181:673/779 of 5i23A
4ba0A Crystal structure of agd31b, alpha-transglucosylase, complexed with 5f-alpha-glcf (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 183:675/781 of 4ba0A
Sites not aligning to the query:
B3PEE6 Oligosaccharide 4-alpha-D-glucosyltransferase; Alpha-glucosidase 31B; CJAgd31B; EC 2.4.1.161 from Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa) (see paper)
28% identity, 53% coverage: 370:880/956 of query aligns to 219:711/816 of B3PEE6
>N515DRAFT_3227 FitnessBrowser__Dyella79:N515DRAFT_3227
MRMSPIANRKWMPWCALALAVLAGCGKAPEQADAAKPAAGHAEKLADGVIVHLDQGTQQV
RLQAVDERIVHVTAVPDGKFELPGSLMAVKTGGATHFTVDETPDAVTLKTERLSARVSLR
DGAVRFLDASGKPLLAERADGRTFQPETVEGKPYYAVRQRFESPADEAFYGLGQHQNRQM
NYKGEDVELAQHNMDVGIPFVVSSRNYGLLWDNNSITRFGDAREYQPLSQSLKLYDVDGK
PGGLTASYYDAGGTLKLKRVEKQPDYQYLKDLTQWPAESPAKTTGKVVWEGSIEPAVSGV
HKLRLYASSYAKVWLDGKLVYDDWRQNWNPWYHNLRLPMDAGSQHKLRIEWLPNEGYLTL
LHLDPLSGDEQNELSLFSEVGHAVDYYFVAGDNLDQVIAGYREITGKATLLPRWAYGFWQ
SRERYKTQAEILDTAKRYRELGLPLDNVVEDWSYWPEDAWGSHDFDKSRFPDAKGLVDQL
HAMHVQLMISVWPKFYPTTKNYQELDAKGYIYRRNVEKGEVDWIGKGYLNAFYDPYAEEA
RHIYWRQIQEKLGAVGIDAWWLDASEPDTHSNLDIAERKLRMGPTALGPGGAFFNSYPLM
HTTGVYDGWRRDHGDRRAFILTRSAFAGQQRNAAATWSGDVASRWSNLHDQISAGLNFSL
AGIPNWTTDIGGFALEPRYEKPGAADLDEWRELNLRWFQFGAFSPLFRSHGQFPYREIYN
LASPGSPVYEALAYYDRLRYRLMPYIYTLAGDTYWKDGTIMRGLAMDFPGDAKVRGIDDE
YMFGPAFLVAPVTEYKATSRPVYLPAGAGWYEFHTGKYHEGGAAIQADAPLARMPLFVRA
GAIVPTGPDIQYTGEKPDAPVTLLVYAGADGQFSLYEDEGTTYGYEKGRYSRIALSYDDK
AKTLTIGKREGDGSGAPAKRQFVVRVIRADKANADGVDAGGDKSVEYDGTTQTVKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory