Comparing N515DRAFT_3232 N515DRAFT_3232 xylose ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
47% identity, 98% coverage: 6:506/513 of query aligns to 3:492/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 44% coverage: 7:234/513 of query aligns to 1:228/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 44% coverage: 7:234/513 of query aligns to 2:229/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 44% coverage: 7:234/513 of query aligns to 2:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 44% coverage: 7:234/513 of query aligns to 2:229/344 of 3tuiC
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 44% coverage: 7:233/513 of query aligns to 3:232/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 44% coverage: 7:233/513 of query aligns to 3:232/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 44% coverage: 7:233/513 of query aligns to 3:232/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 44% coverage: 7:233/513 of query aligns to 3:232/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 44% coverage: 7:233/513 of query aligns to 2:230/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 41% coverage: 13:223/513 of query aligns to 7:212/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 11:227/513 of query aligns to 8:230/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 11:227/513 of query aligns to 8:230/253 of 1g9xB
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 44% coverage: 7:233/513 of query aligns to 4:229/648 of P75831
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 41% coverage: 280:487/513 of query aligns to 17:222/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 41% coverage: 280:487/513 of query aligns to 17:222/250 of 7z18I
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 43% coverage: 6:227/513 of query aligns to 1:216/240 of 6mjpA
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
32% identity, 41% coverage: 280:487/513 of query aligns to 17:222/250 of 7z16I
Sites not aligning to the query:
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
29% identity, 41% coverage: 13:223/513 of query aligns to 7:213/219 of 8w6iD
6qexA Nanodisc reconstituted human abcb1 in complex with uic2 fab and taxol (see paper)
31% identity, 40% coverage: 20:224/513 of query aligns to 956:1156/1182 of 6qexA
Sites not aligning to the query:
>N515DRAFT_3232 N515DRAFT_3232 xylose ABC transporter ATP-binding protein
MAGESCLFEMRGIAKSFGGVKALDGIDLRLRAGECLGLCGENGAGKSTLMKVLSGVYPHG
SWDGEILWQGQPLRARSVRDSERAGIVIIHQELMLVPQLSVAENIFLGHEITRPGGRMDY
DAMYAKADALLQELGLHDVNVALPAMHYGGGHQQLFEIAKALAKQAKLLILDEPTSSLTS
SETEVLLGIVEDLKRRGVACIYISHKLDEVERVCDTVCVIRDGRHIATQPMHELDVDTLI
TLMVGRKLENLYPRIEHAIGEVIFEARHATCLDPVNPQRKRVDDVSFQLRRGEILGIAGL
VGAGRTELVSAIFGAYTGKSSVELFLEGRPLKIRSPADAIRAGLGMVPEDRKRHGIVPLL
GVGDNITLATLDHYAHAGHIDRQRELVAIEAQIAERRVKTASPALPIARLSGGNQQKAVL
AKMLLARPKVLILDEPTRGVDVGAKAEIYRLIFELAAQGVAIVLVSSEMPEVLGMADRVL
VMGEGRLRGDFPNQGLTQEQVLAAAIDTSARAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory