SitesBLAST
Comparing N515DRAFT_3307 FitnessBrowser__Dyella79:N515DRAFT_3307 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6w80A Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from stenotrophomonas maltophilia k279a in complex with plp
79% identity, 97% coverage: 3:414/426 of query aligns to 11:419/430 of 6w80A
- active site: V26 (= V18), Y149 (= Y141), D241 (= D236), K269 (= K264)
- binding pyridoxal-5'-phosphate: S121 (= S113), G122 (= G114), T123 (= T115), Y149 (= Y141), H150 (= H142), E208 (= E203), N213 (= N208), D241 (= D236), V243 (= V238), K269 (= K264)
P23893 Glutamate-1-semialdehyde 2,1-aminomutase; GSA; Glutamate-1-semialdehyde aminotransferase; GSA-AT; EC 5.4.3.8 from Escherichia coli (strain K12) (see paper)
63% identity, 98% coverage: 3:421/426 of query aligns to 4:423/426 of P23893
- K265 (= K264) mutation to R: 2% of wild-type activity.
5i92F Crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa
62% identity, 99% coverage: 3:423/426 of query aligns to 4:420/420 of 5i92F
2gsaB Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
58% identity, 99% coverage: 1:423/426 of query aligns to 4:426/427 of 2gsaB
- active site: V21 (= V18), Y144 (= Y141), E206 (= E203), D239 (= D236), M242 (= M239), K267 (= K264), A401 (= A398)
- binding pyridoxal-5'-phosphate: G117 (= G114), T118 (= T115), Y144 (= Y141), E206 (= E203), N211 (= N208), D239 (= D236), V241 (= V238), M242 (= M239), K267 (= K264)
2gsaA Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
58% identity, 99% coverage: 1:423/426 of query aligns to 4:426/427 of 2gsaA
- active site: V21 (= V18), Y144 (= Y141), E206 (= E203), D239 (= D236), M242 (= M239), K267 (= K264), A401 (= A398)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G114), T118 (= T115), Y144 (= Y141), H145 (= H142), G146 (= G143), N211 (= N208), D239 (= D236), V241 (= V238), K267 (= K264)
3usfA Crystal structure of dava-4
58% identity, 99% coverage: 1:423/426 of query aligns to 4:426/427 of 3usfA
- active site: V21 (= V18), Y144 (= Y141), D239 (= D236), M242 (= M239), K267 (= K264), A401 (= A398)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S20), V25 (= V22), S157 (= S154), K267 (= K264), E400 (= E397)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G114), T118 (= T115), Y144 (= Y141), N211 (= N208), D239 (= D236), V241 (= V238), K267 (= K264)
3fq7A Gabaculine complex of gsam (see paper)
58% identity, 99% coverage: 1:423/426 of query aligns to 4:426/427 of 3fq7A
- active site: V21 (= V18), Y144 (= Y141), D239 (= D236), M242 (= M239), K267 (= K264), A401 (= A398)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: S23 (= S20), V25 (= V22), W61 (= W58), G117 (= G114), T118 (= T115), Y144 (= Y141), H145 (= H142), E206 (= E203), N211 (= N208), D239 (= D236), V241 (= V238), M242 (= M239), K267 (= K264), G298 (= G295), T299 (= T296), E400 (= E397)
2hp2A Inter-subunit signaling in gsam (see paper)
58% identity, 99% coverage: 1:423/426 of query aligns to 4:426/427 of 2hp2A
- active site: V21 (= V18), Y144 (= Y141), D239 (= D236), M242 (= M239), K267 (= K264), A401 (= A398)
- binding (4s)-4,5-diaminopentanoic acid: G298 (= G295), T299 (= T296)
- binding (4r)-5-amino-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S20), G117 (= G114), T118 (= T115), Y144 (= Y141), H145 (= H142), E206 (= E203), N211 (= N208), D239 (= D236), V241 (= V238), M242 (= M239), K267 (= K264)
- binding pyridoxal-5'-phosphate: G298 (= G295), T299 (= T296)
2hp1A Inter-subunit signaling in gsam (see paper)
58% identity, 99% coverage: 1:423/426 of query aligns to 4:426/427 of 2hp1A
- active site: V21 (= V18), Y144 (= Y141), D239 (= D236), M242 (= M239), K267 (= K264), A401 (= A398)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S20), V25 (= V22), W61 (= W58), S116 (= S113), G117 (= G114), T118 (= T115), Y144 (= Y141), H145 (= H142), G146 (= G143), E206 (= E203), N211 (= N208), D239 (= D236), V241 (= V238), M242 (= M239), K267 (= K264), E400 (= E397)
2hozA Inter-subunit signaling in gsam (see paper)
58% identity, 99% coverage: 1:423/426 of query aligns to 4:426/427 of 2hozA
- active site: V21 (= V18), Y144 (= Y141), D239 (= D236), M242 (= M239), K267 (= K264), A401 (= A398)
- binding (4s)-4,5-diaminopentanoic acid: E141 (= E138), G156 (= G153), S157 (= S154), P182 (≠ A179), N368 (≠ S365), E370 (≠ A367), K373 (≠ T370)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G114), T118 (= T115), Y144 (= Y141), H145 (= H142), G146 (= G143), E206 (= E203), N211 (= N208), D239 (= D236), G298 (= G295), T299 (= T296)
3fqaA Gabaculien complex of gabaculine resistant gsam version (see paper)
58% identity, 99% coverage: 1:423/426 of query aligns to 3:425/426 of 3fqaA
- active site: V20 (= V18), Y143 (= Y141), D238 (= D236), I241 (≠ M239), K266 (= K264), A400 (= A398)
- binding 3-aminobenzoic acid: S22 (= S20), R25 (= R23), W60 (= W58)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G116 (= G114), T117 (= T115), Y143 (= Y141), E205 (= E203), N210 (= N208), D238 (= D236), V240 (= V238), I241 (≠ M239)
P42799 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic; AtGSA1; GSA 1; Glutamate-1-semialdehyde aminotransferase 1; GSA-AT 1; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
56% identity, 98% coverage: 3:421/426 of query aligns to 53:471/474 of P42799
- K314 (= K264) modified: N6-(pyridoxal phosphate)lysine
5hdmB Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
56% identity, 98% coverage: 3:421/426 of query aligns to 7:425/428 of 5hdmB
- active site: V22 (= V18), Y145 (= Y141), E207 (= E203), D240 (= D236), M243 (= M239), K268 (= K264), A402 (= A398)
- binding pyridoxal-5'-phosphate: G118 (= G114), T119 (= T115), Y145 (= Y141), E207 (= E203), N212 (= N208), D240 (= D236), V242 (= V238), M243 (= M239), K268 (= K264)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G114), T119 (= T115), Y145 (= Y141), E207 (= E203), N212 (= N208), D240 (= D236), V242 (= V238), M243 (= M239), K268 (= K264)
5hdmA Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
56% identity, 98% coverage: 3:421/426 of query aligns to 7:425/428 of 5hdmA
- active site: V22 (= V18), Y145 (= Y141), E207 (= E203), D240 (= D236), M243 (= M239), K268 (= K264), A402 (= A398)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G114), T119 (= T115), Y145 (= Y141), G147 (= G143), E207 (= E203), N212 (= N208), D240 (= D236), V242 (= V238), K268 (= K264)
3bs8A Crystal structure of glutamate 1-semialdehyde aminotransferase complexed with pyridoxamine-5'-phosphate from bacillus subtilis (see paper)
55% identity, 97% coverage: 7:421/426 of query aligns to 11:424/430 of 3bs8A
- active site: V22 (= V18), Y145 (= Y141), E207 (= E203), D240 (= D236), M243 (= M239), K268 (= K264), G401 (≠ A398)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G114), T119 (= T115), Y145 (= Y141), H146 (= H142), E207 (= E203), N212 (= N208), D240 (= D236), V242 (= V238), K268 (= K264)
Q42522 Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic; GSA 2; Glutamate-1-semialdehyde aminotransferase 2; GSA-AT 2; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
56% identity, 98% coverage: 3:421/426 of query aligns to 51:469/472 of Q42522
- R92 (≠ W44) mutation to K: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with S-162.
- G162 (= G114) mutation to S: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with K-92.
2e7uA Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from thermus thermophilus hb8
56% identity, 97% coverage: 7:421/426 of query aligns to 10:424/424 of 2e7uA
- active site: V21 (= V18), Y144 (= Y141), E206 (= E203), D238 (= D236), M241 (= M239), K266 (= K264), A401 (= A398)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G114), T118 (= T115), Y144 (= Y141), H145 (= H142), N211 (= N208), D238 (= D236), V240 (= V238)
3usfB Crystal structure of dava-4
54% identity, 99% coverage: 1:423/426 of query aligns to 4:401/402 of 3usfB
- active site: V21 (= V18), Y144 (= Y141), E181 (= E203), D214 (= D236), M217 (= M239), K242 (= K264), A376 (= A398)
- binding (4s)-4,5-diaminopentanoic acid: G273 (= G295), T274 (= T296)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G114), T118 (= T115), Y144 (= Y141), E181 (= E203), N186 (= N208), D214 (= D236), V216 (= V238), M217 (= M239), K242 (= K264)
2hp1B Inter-subunit signaling in gsam (see paper)
54% identity, 99% coverage: 1:423/426 of query aligns to 4:397/398 of 2hp1B
- active site: V21 (= V18), Y144 (= Y141), E177 (= E203), D210 (= D236), M213 (= M239), K238 (= K264), A372 (= A398)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: G269 (= G295), T270 (= T296)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S20), V25 (= V22), R26 (= R23), W61 (= W58), Y144 (= Y141)
- binding pyridoxal-5'-phosphate: S116 (= S113), G117 (= G114), T118 (= T115), Y144 (= Y141), E177 (= E203), N182 (= N208), D210 (= D236), V212 (= V238), M213 (= M239), K238 (= K264)
3k28A Crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate
55% identity, 95% coverage: 7:409/426 of query aligns to 11:407/423 of 3k28A
- active site: V22 (= V18), Y145 (= Y141), E202 (= E203), D235 (= D236), M238 (= M239), K263 (= K264), G396 (≠ A398)
- binding calcium ion: I103 (≠ T99), V106 (= V102), P107 (= P103), I109 (≠ V105)
- binding pyridoxal-5'-phosphate: G118 (= G114), T119 (= T115), Y145 (= Y141), H146 (= H142), G147 (= G143), E202 (= E203), D235 (= D236), V237 (= V238), M238 (= M239), K263 (= K264)
Query Sequence
>N515DRAFT_3307 FitnessBrowser__Dyella79:N515DRAFT_3307
MTNHELFQRAKQLMPGGVNSPVRAFKSVGGEPFFTARADGAYLWDVEGKRYIDYVGSWGP
MIVGHNHPRVREAVERAVKDGLSFGTPCPAEITMAETITRLVPSVDMVRMVNSGTEATMS
AIRLARGATGRSKIVKFEGCYHGHGDSFLVKAGSGALTFGVPTSPGVPKAAADLTLTLAY
NDLAAAEALFAEHGADIAGLIIEPVAGNMNCIPPKDGYLQGLRALCTRHGALLIFDEVMT
GFRVALGGAQAHYGITPDLSTFGKIIGGGMPVGAYGGRRELMEQIAPAGPIYQAGTLSGN
PVAMAAGLAMLELIQEAGFYDRLAARTRLLADGLQAVADGEGVPFSTNRVGAMFGLFFTQ
EKVESYAHATAADTAAFNRFFHGMLERGVYLAPSAFEAGFLSSAHSDEDLAATLEAARQT
LRASRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory