Comparing N515DRAFT_3310 FitnessBrowser__Dyella79:N515DRAFT_3310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
38% identity, 86% coverage: 1:121/140 of query aligns to 1:126/128 of 4mttA
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
35% identity, 86% coverage: 1:120/140 of query aligns to 1:125/135 of P0AC81
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
35% identity, 86% coverage: 1:120/140 of query aligns to 1:125/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
35% identity, 86% coverage: 1:120/140 of query aligns to 1:125/128 of 1fa5A
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
31% identity, 83% coverage: 5:120/140 of query aligns to 20:162/167 of 4x2aA
Sites not aligning to the query:
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
31% identity, 83% coverage: 5:120/140 of query aligns to 31:173/180 of 2za0A
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
31% identity, 83% coverage: 5:120/140 of query aligns to 29:171/179 of 4kykA
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
31% identity, 83% coverage: 5:120/140 of query aligns to 34:176/184 of Q9CPU0
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
31% identity, 83% coverage: 5:120/140 of query aligns to 22:164/170 of 4pv5A
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
31% identity, 83% coverage: 5:120/140 of query aligns to 27:169/177 of 6l0uB
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
31% identity, 83% coverage: 5:120/140 of query aligns to 27:169/177 of 4kykB
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
31% identity, 83% coverage: 5:120/140 of query aligns to 29:171/177 of 4kyhA
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
32% identity, 96% coverage: 4:138/140 of query aligns to 5:137/139 of 2c21A
4opnA Crystal structure of mouse glyoxalase i complexed with mah
31% identity, 83% coverage: 5:120/140 of query aligns to 26:168/172 of 4opnA
Sites not aligning to the query:
6bnnA Crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 (see paper)
32% identity, 84% coverage: 4:121/140 of query aligns to 18:140/282 of 6bnnA
Sites not aligning to the query:
5d7zA Crystal structure of glyoxalase i from zea mays (see paper)
32% identity, 84% coverage: 4:121/140 of query aligns to 12:134/281 of 5d7zA
Sites not aligning to the query:
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
30% identity, 83% coverage: 5:120/140 of query aligns to 34:176/184 of Q04760
Sites not aligning to the query:
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
30% identity, 83% coverage: 5:120/140 of query aligns to 26:168/176 of 3w0tA
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
30% identity, 83% coverage: 5:120/140 of query aligns to 26:168/176 of 3vw9A
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
30% identity, 83% coverage: 5:120/140 of query aligns to 26:168/176 of 1qipA
Sites not aligning to the query:
>N515DRAFT_3310 FitnessBrowser__Dyella79:N515DRAFT_3310
MKYLHSMVRVRDVDASLRFFCDGLGLQETRRMESAAGKFTLIYLAAPASPEAEVELTYNW
DSDEDYGSARNFGHLAFEVDDIYRTCRHLQDLGYTINRPPRDGHMAFVRSPDLISIELLQ
RDGRLPPQEPWASMPNTGVW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory