SitesBLAST
Comparing N515DRAFT_3371 FitnessBrowser__Dyella79:N515DRAFT_3371 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ydbA Crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
60% identity, 97% coverage: 2:145/149 of query aligns to 1:144/145 of 5ydbA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N74 (= N75), A77 (= A78), E98 (= E99), H100 (= H101), R107 (= R108)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: N74 (= N75), A76 (≠ G77), A77 (= A78), H80 (= H81), H100 (= H101), L101 (= L102), S102 (= S103), R111 (= R112)
5b6pB Structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution (see paper)
60% identity, 97% coverage: 2:145/149 of query aligns to 1:144/145 of 5b6pB
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N74 (= N75), A77 (= A78), E98 (= E99), H100 (= H101), R107 (= R108)
- binding sulfate ion: N74 (= N75), H100 (= H101), L101 (= L102), S102 (= S103)
8idrC Crystal structure of apo-form of dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
53% identity, 97% coverage: 2:145/149 of query aligns to 2:146/147 of 8idrC
8iduA Crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
52% identity, 96% coverage: 2:144/149 of query aligns to 2:145/145 of 8iduA
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y23 (= Y23), N74 (= N75), G76 (= G77), G77 (≠ A78), H80 (= H81), H100 (= H101), I101 (≠ L102), S102 (= S103), R111 (= R112)
Q48255 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/167 of Q48255
- N76 (= N75) binding substrate
- H82 (= H81) binding substrate
- D89 (= D88) binding substrate
- R113 (= R112) binding substrate
4b6sA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/158 of 4b6sA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N75), A79 (= A78), E100 (= E99), H102 (= H101), R109 (= R108)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N11), L14 (= L15), Y22 (= Y23), N76 (= N75), G78 (= G77), A79 (= A78), H82 (= H81), H102 (= H101), L103 (= L102), T104 (≠ S103), R113 (= R112)
2xb9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3-dehydroquinic acid (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/158 of 2xb9A
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N75), A79 (= A78), E100 (= E99), H102 (= H101), R109 (= R108)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N11), Y22 (= Y23), N76 (= N75), A79 (= A78), H82 (= H81), H102 (= H101), L103 (= L102), T104 (≠ S103), R113 (= R112)
1j2yA Crystal structure of the type ii 3-dehydroquinase (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/158 of 1j2yA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N75), A79 (= A78), E100 (= E99), H102 (= H101), R109 (= R108)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y22 (= Y23), N76 (= N75), G78 (= G77), H82 (= H81), H102 (= H101), L103 (= L102), T104 (≠ S103), R113 (= R112)
2xdaA Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-2-(2-cyclopropyl)ethyl-4,6,7- trihydroxy-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/150 of 2xdaA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N75), A79 (= A78), E100 (= E99), H102 (= H101), R109 (= R108)
- binding (4r,6r,7s)-2-(2-cyclopropylethyl)-4,6,7-trihydroxy-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N11), L11 (= L12), M13 (≠ L14), Y22 (= Y23), N76 (= N75), A79 (= A78), H82 (= H81), H102 (= H101), L103 (= L102), T104 (≠ S103), R113 (= R112)
2c4wA Type ii dehydroquinase from h. Pylori in complex with ah9095 (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 11:159/168 of 2c4wA
- active site: P18 (= P10), N19 (= N11), R26 (= R18), Y31 (= Y23), N85 (= N75), A88 (= A78), E109 (= E99), H111 (= H101), R118 (= R108)
- binding n-tetrazol-5-yl 9-oxo-9h-xanthene-2 sulphonamide: L20 (= L12), L23 (= L15), D27 (≠ E19), G87 (= G77), H91 (= H81), H111 (= H101), L112 (= L102), T113 (≠ S103), I115 (≠ V105), R122 (= R112)
4b6rA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/157 of 4b6rA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N75), A79 (= A78), E100 (= E99), H102 (= H101), R109 (= R108)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: Y22 (= Y23), N76 (= N75), G78 (= G77), A79 (= A78), H82 (= H81), D89 (= D88), L93 (≠ A92), H102 (= H101), L103 (= L102), T104 (≠ S103), R113 (= R112)
2xd9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/153 of 2xd9A
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N75), A79 (= A78), E100 (= E99), H102 (= H101), R109 (= R108)
- binding (4r,6r,7s)-4,6,7-trihydroxy-2-[(1e)-prop-1-en-1-yl]-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N11), L14 (= L15), Y22 (= Y23), N76 (= N75), G78 (= G77), A79 (= A78), H82 (= H81), H102 (= H101), L103 (= L102), T104 (≠ S103), R113 (= R112)
2wksA Structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor. (see paper)
44% identity, 99% coverage: 3:149/149 of query aligns to 2:150/153 of 2wksA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N75), A79 (= A78), E100 (= E99), H102 (= H101), R109 (= R108)
- binding (1R,4S,5R)-1,4,5-trihydroxy-3-[(5-methyl-1-benzothiophen-2-yl)methoxy]cyclohex-2-ene-1-carboxylic acid: L11 (= L12), Y22 (= Y23), N76 (= N75), G78 (= G77), A79 (= A78), H82 (= H81), H102 (= H101), L103 (= L102), T104 (≠ S103), R113 (= R112)
P15474 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
49% identity, 92% coverage: 2:138/149 of query aligns to 8:144/157 of P15474
- R24 (= R18) mutation to A: Reduces kcat 30000-fold. Reduces KM for 3-dehydroquinate 6-fold.; mutation to K: Reduces kcat 2700-fold. Reduces KM for 3-dehydroquinate 4-fold.; mutation to Q: Reduces kcat 3100-fold. Reduces KM for 3-dehydroquinate 8-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2cjfA Type ii dehydroquinase inhibitor complex (see paper)
49% identity, 92% coverage: 2:138/149 of query aligns to 6:142/149 of 2cjfA
- binding (1s,4s,5s)-1,4,5-trihydroxy-3-[3-(phenylthio)phenyl]cyclohex-2-ene-1-carboxylic acid: N15 (= N11), L16 (= L12), L18 (= L14), L19 (= L15), R22 (= R18), Y27 (= Y23), N78 (= N75), A80 (≠ G77), A81 (= A78), H84 (= H81), H105 (= H101), I106 (≠ L102), S107 (= S103), R116 (= R112)
2bt4A Type ii dehydroquinase inhibitor complex (see paper)
49% identity, 92% coverage: 2:138/149 of query aligns to 6:142/149 of 2bt4A
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N15 (= N11), L18 (= L14), R22 (= R18), Y27 (= Y23), N78 (= N75), A80 (≠ G77), A81 (= A78), H84 (= H81), H105 (= H101), I106 (≠ L102), S107 (= S103), R116 (= R112)
1gu1A Crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with 2,3-anhydro-quinic acid (see paper)
49% identity, 92% coverage: 2:138/149 of query aligns to 6:142/149 of 1gu1A
- active site: P14 (= P10), N15 (= N11), R22 (= R18), Y27 (= Y23), N78 (= N75), A81 (= A78), E103 (= E99), H105 (= H101), R112 (= R108)
- binding 2,3 -anhydro-quinic acid: Y27 (= Y23), N78 (= N75), A80 (≠ G77), A81 (= A78), H84 (= H81), H105 (= H101), I106 (≠ L102), S107 (= S103), R116 (= R112)
- binding glycerol: N15 (= N11), L16 (= L12), L19 (= L15), Y27 (= Y23)
1v1jA Crystal structure of type ii dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro (see paper)
49% identity, 92% coverage: 2:138/149 of query aligns to 7:143/150 of 1v1jA
- active site: P15 (= P10), N16 (= N11), R23 (= R18), Y28 (= Y23), N79 (= N75), A82 (= A78), E104 (= E99), H106 (= H101), R113 (= R108)
- binding 2-anhydro-3-fluoro-quinic acid: Y28 (= Y23), N79 (= N75), A81 (≠ G77), A82 (= A78), H85 (= H81), H106 (= H101), I107 (≠ L102), S108 (= S103), R117 (= R112)
4cl0A Structure of the mycobacterium tuberculosis type ii dehydroquinase inhibited by a 3-dehydroquinic acid derivative
53% identity, 89% coverage: 6:137/149 of query aligns to 5:135/140 of 4cl0A
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N73 (= N75), G76 (≠ A78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding (2r)-2-methyl-3-dehydroquinic acid: R17 (= R18), Y22 (= Y23), N73 (= N75), G75 (= G77), G76 (≠ A78), H79 (= H81), H99 (= H101), I100 (≠ L102), S101 (= S103), R110 (= R112)
4kiwA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] (see paper)
53% identity, 89% coverage: 6:137/149 of query aligns to 5:135/141 of 4kiwA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N73 (= N75), G76 (≠ A78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding 5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid: N10 (= N11), L11 (= L12), R13 (≠ L14), L14 (= L15), Y22 (= Y23), N73 (= N75), G75 (= G77), G76 (≠ A78), H79 (= H81), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (= V105), R110 (= R112)
Query Sequence
>N515DRAFT_3371 FitnessBrowser__Dyella79:N515DRAFT_3371
MAKILVLHGPNLNLLGAREPEIYGHTTLADINAALAARAREAGHELAWYQSNAEHELIGR
IHQARDEQVATILFNPGAFTHTSIALRDALAAVAIPFVEVHLSNVHAREPFRRHSYLADI
AVGVICGFGPDSYRLALEAALSRLERTAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory