Comparing N515DRAFT_3391 FitnessBrowser__Dyella79:N515DRAFT_3391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wzaA Crystal structure of alpha-amylase from h.Orenii (see paper)
46% identity, 92% coverage: 41:526/526 of query aligns to 2:486/488 of 1wzaA
5m99A Functional characterization and crystal structure of thermostable amylase from thermotoga petrophila, reveals high thermostability and an archaic form of dimerization (see paper)
37% identity, 82% coverage: 47:479/526 of query aligns to 9:453/506 of 5m99A
7jjnA Eubacterium rectale amy13b (eur_01860)
33% identity, 91% coverage: 47:526/526 of query aligns to 26:510/514 of 7jjnA
7jjtA Ruminococcus bromii amylase amy5 (rbr_07800)
32% identity, 91% coverage: 46:526/526 of query aligns to 21:510/513 of 7jjtA
4lxfB Crystal structure of m. Tuberculosis tres (see paper)
33% identity, 91% coverage: 25:502/526 of query aligns to 17:516/546 of 4lxfB
2ze0A Alpha-glucosidase gsj (see paper)
33% identity, 85% coverage: 43:491/526 of query aligns to 7:493/531 of 2ze0A
6y9tA Family gh13_31 enzyme (see paper)
30% identity, 92% coverage: 44:526/526 of query aligns to 8:534/536 of 6y9tA
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
30% identity, 89% coverage: 38:503/526 of query aligns to 2:511/546 of 5x7uA
Sites not aligning to the query:
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
32% identity, 85% coverage: 43:487/526 of query aligns to 6:502/537 of 4aieA
1lwjA Crystal structure of t. Maritima 4-alpha-glucanotransferase/acarbose complex (see paper)
34% identity, 84% coverage: 47:488/526 of query aligns to 4:429/441 of 1lwjA
1lwhA Crystal structure of t. Maritima 4-alpha-glucanotransferase (see paper)
34% identity, 84% coverage: 47:488/526 of query aligns to 4:429/441 of 1lwhA
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
32% identity, 86% coverage: 43:492/526 of query aligns to 6:516/555 of 5brpA
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
34% identity, 86% coverage: 38:490/526 of query aligns to 1:505/548 of 5gtwA
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
33% identity, 86% coverage: 38:490/526 of query aligns to 1:481/523 of 5ykbD
4lxfA Crystal structure of m. Tuberculosis tres (see paper)
31% identity, 91% coverage: 25:502/526 of query aligns to 17:540/570 of 4lxfA
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
30% identity, 91% coverage: 47:524/526 of query aligns to 10:542/546 of 8ibkA
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
31% identity, 85% coverage: 43:489/526 of query aligns to 8:517/556 of 2pwgA
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
31% identity, 85% coverage: 43:489/526 of query aligns to 9:518/557 of 4h8vA
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
31% identity, 85% coverage: 43:489/526 of query aligns to 9:518/557 of 2pwdA
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
31% identity, 85% coverage: 43:489/526 of query aligns to 8:517/556 of 2pweA
>N515DRAFT_3391 FitnessBrowser__Dyella79:N515DRAFT_3391
MPPFRALSRLTVAFALALGATVAYAADSTPPVATSTAPKTQGSGVWYEIFVRAWYDTNGD
GIGDLNGVTAKLDYLQSLGVSGIWLMPINPSPTYHGYDVTDYEGINPQYGSMADFEKLVS
EAHKRGIEVIIDLVINHSSDQHPWFKSALDPHSQYRHWYTWAGKDTDLKAISAVDGPAWH
ANGKQHYLGDFTGAMPDLNYDEPAVRREMIAIGKFWLSKGADGFRLDAARHIYDDLKSDN
GQPAVIRKNAQWWSEFRQGLRQVRPDVYLVGEVSARQPGELAPYLPALGSVFDFPLAEQL
IASAKQEQAGKLPALLTESYAAFHAAAGDDYADAPFLSNHDQERVLSQLGGDLHHMRTAA
AMLLTLPGRPYIYYGEEIGMLGRKPDENLREPMRWQRTPAAPGDSRWKTYSVKQGGDVSV
QAERDQPDSLLNLYRTLIHWRVEVPALRDGALRVIATGKPALVAYERATADSRALVVHNL
SGKPGSFKLDGDSAKAFSAIRLHTVPGATLANGQLTLPAYATVVLQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory