SitesBLAST
Comparing N515DRAFT_3393 FitnessBrowser__Dyella79:N515DRAFT_3393 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
56% identity, 99% coverage: 6:541/541 of query aligns to 4:535/535 of 3wy2A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), E268 (= E270), H329 (= H330), D330 (= D331)
- binding beta-D-glucopyranose: D59 (= D61), Y62 (= Y64), H102 (= H104), R197 (= R199), D199 (= D201), E268 (= E270), H329 (= H330), D330 (= D331), R397 (= R403)
- binding glycerol: S101 (= S103), D169 (= D171), V170 (≠ L172), P175 (= P177), R178 (≠ Q180), Q179 (≠ R181), F203 (= F205), Y204 (≠ C206), H206 (= H208), D240 (≠ N242), P244 (= P246), E280 (= E282)
- binding magnesium ion: D20 (= D22), R22 (≠ D24), V26 (= V28), D28 (= D30)
3wy1A Crystal structure of alpha-glucosidase (see paper)
56% identity, 99% coverage: 6:541/541 of query aligns to 4:535/535 of 3wy1A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), E268 (= E270), H329 (= H330), D330 (= D331)
- binding glycerol: S101 (= S103), D169 (= D171), V170 (≠ L172), F203 (= F205), Y204 (≠ C206), H206 (= H208)
- binding magnesium ion: D20 (= D22), D24 (= D26), V26 (= V28), D28 (= D30)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D61), Y62 (= Y64), H102 (= H104), F144 (= F146), F163 (= F165), R197 (= R199), D199 (= D201), T200 (≠ A202), G225 (= G227), E268 (= E270), F294 (= F295), H329 (= H330), D330 (= D331), R397 (= R403)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
55% identity, 99% coverage: 6:541/541 of query aligns to 4:535/535 of 3wy4A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), Q268 (≠ E270), H329 (= H330), D330 (= D331)
- binding alpha-D-glucopyranose: D59 (= D61), Y62 (= Y64), H102 (= H104), I143 (≠ L145), F163 (= F165), D199 (= D201), T200 (≠ A202), G225 (= G227), Q268 (≠ E270), Q268 (≠ E270), F294 (= F295), H329 (= H330), D330 (= D331), R397 (= R403), R397 (= R403)
- binding glycerol: S101 (= S103), D169 (= D171), V170 (≠ L172), F203 (= F205), Y204 (≠ C206), H206 (= H208), L224 (≠ R226), G225 (= G227), A226 (≠ F228), P227 (≠ S229), F294 (= F295), D330 (= D331), E374 (= E380), K395 (= K401), G396 (= G402), G399 (= G405)
- binding magnesium ion: D20 (= D22), D24 (= D26), V26 (= V28), D28 (= D30)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
54% identity, 68% coverage: 6:375/541 of query aligns to 4:323/421 of 3wy4B
- active site: D75 (= D99), R175 (= R199), D177 (= D201), Q237 (≠ E270)
- binding glycerol: S79 (= S103), N140 (= N164), D147 (= D171), F181 (= F205), Y182 (≠ C206), F183 (= F207), H184 (= H208), D209 (≠ N242)
2ze0A Alpha-glucosidase gsj (see paper)
40% identity, 92% coverage: 3:501/541 of query aligns to 1:486/531 of 2ze0A
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
37% identity, 96% coverage: 5:524/541 of query aligns to 5:530/557 of 4h8vA
- active site: D99 (= D99), R198 (= R199), D200 (= D201), E254 (= E270), H326 (= H330), D327 (= D331)
- binding calcium ion: D22 (= D22), N24 (≠ D24), D26 (= D26), I28 (≠ V28), D30 (= D30)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D61), Y64 (= Y64), H104 (= H104), F164 (= F165), D200 (= D201), E254 (= E270), F256 (≠ S272), R284 (≠ T299), R291 (vs. gap), H326 (= H330), D327 (= D331), E386 (≠ T395), R414 (= R403)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
37% identity, 96% coverage: 5:524/541 of query aligns to 5:530/557 of 2pwdA
- active site: D99 (= D99), R198 (= R199), D200 (= D201), E254 (= E270), H326 (= H330), D327 (= D331)
- binding calcium ion: D22 (= D22), N24 (≠ D24), D26 (= D26), I28 (≠ V28), D30 (= D30)
- binding 1-deoxynojirimycin: D61 (= D61), Y64 (= Y64), H104 (= H104), F164 (= F165), D200 (= D201), E254 (= E270), H326 (= H330), D327 (= D331), R414 (= R403)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
37% identity, 96% coverage: 5:524/541 of query aligns to 4:529/556 of 2pwgA
- active site: D98 (= D99), R197 (= R199), D199 (= D201), E253 (= E270), H325 (= H330), D326 (= D331)
- binding calcium ion: D21 (= D22), N23 (≠ D24), D25 (= D26), I27 (≠ V28), D29 (= D30)
- binding castanospermine: D60 (= D61), Y63 (= Y64), H103 (= H104), F163 (= F165), D199 (= D201), E253 (= E270), D326 (= D331), R413 (= R403)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
37% identity, 96% coverage: 5:524/541 of query aligns to 4:529/556 of 2pweA
- active site: D98 (= D99), R197 (= R199), D199 (= D201), Q253 (≠ E270), H325 (= H330), D326 (= D331)
- binding calcium ion: D21 (= D22), N23 (≠ D24), D25 (= D26), I27 (≠ V28), D29 (= D30)
- binding beta-D-fructofuranose: F163 (= F165), Q253 (≠ E270), F255 (≠ S272), D326 (= D331), R413 (= R403)
- binding alpha-D-glucopyranose: D60 (= D61), Y63 (= Y64), H103 (= H104), F163 (= F165), D199 (= D201), Q253 (≠ E270), H325 (= H330), D326 (= D331), R413 (= R403)
2pwfA Crystal structure of the mutb d200a mutant in complex with glucose (see paper)
37% identity, 96% coverage: 5:524/541 of query aligns to 3:528/555 of 2pwfA
- active site: D97 (= D99), R196 (= R199), A198 (≠ D201), E252 (= E270), H324 (= H330), D325 (= D331)
- binding beta-D-glucopyranose: D59 (= D61), Y62 (= Y64), H102 (= H104), F162 (= F165), R196 (= R199), A198 (≠ D201), E252 (= E270), H324 (= H330), D325 (= D331), R412 (= R403)
- binding calcium ion: D20 (= D22), N22 (≠ D24), D24 (= D26), I26 (≠ V28), D28 (= D30)
4ha1A Mutb inactive double mutant d200a-d415n in complex with isomaltulose
37% identity, 96% coverage: 5:524/541 of query aligns to 4:529/556 of 4ha1A
- active site: D98 (= D99), R197 (= R199), A199 (≠ D201), E253 (= E270), H325 (= H330), D326 (= D331)
- binding calcium ion: D21 (= D22), N23 (≠ D24), D25 (= D26), I27 (≠ V28), D29 (= D30)
- binding 6-O-alpha-D-glucopyranosyl-D-fructose: D60 (= D61), Y63 (= Y64), H103 (= H104), F163 (= F165), E253 (= E270), R283 (≠ T299), H325 (= H330), D326 (= D331), E385 (≠ T395), R413 (= R403)
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
35% identity, 94% coverage: 1:507/541 of query aligns to 1:523/561 of O06994
- D20 (= D22) binding
- N22 (≠ D24) binding
- D24 (= D26) binding
- F26 (≠ V28) binding
- D28 (= D30) binding
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
35% identity, 93% coverage: 6:507/541 of query aligns to 2:521/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
35% identity, 93% coverage: 6:507/541 of query aligns to 2:521/559 of 7lv6B
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
35% identity, 93% coverage: 6:507/541 of query aligns to 2:518/555 of 4m56A
- active site: D95 (= D99), R195 (= R199), D197 (= D201), E250 (= E270), H326 (= H330), D327 (= D331)
- binding D-glucose: D57 (= D61), Y60 (= Y64), H100 (= H104), F142 (= F146), D197 (= D201), E250 (= E270), D327 (= D331), R413 (= R403)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
35% identity, 93% coverage: 6:507/541 of query aligns to 2:518/556 of 5wczA
- active site: D95 (= D99), R195 (= R199), D197 (= D201), E250 (= E270), H326 (= H330), D327 (= D331)
- binding 1-deoxynojirimycin: D57 (= D61), Y60 (= Y64), H100 (= H104), F161 (= F165), D197 (= D201), V198 (≠ A202), E250 (= E270), H326 (= H330), D327 (= D331), R413 (= R403)
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
34% identity, 92% coverage: 4:502/541 of query aligns to 5:533/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D61), Y65 (= Y64), H105 (= H104), Y150 (≠ L145), F170 (= F165), D207 (= D201), T208 (≠ A202), E265 (= E270), F291 (= F295), H338 (= H330), D339 (= D331), R431 (= R403), T529 (≠ G498), D530 (≠ S499)
- binding calcium ion: D23 (= D22), N25 (≠ D24), D27 (= D26), I29 (≠ V28), D31 (= D30)
- binding alpha-D-glucopyranose: R224 (≠ K218), F291 (= F295), A295 (vs. gap), E300 (vs. gap), S349 (≠ R341), D350 (≠ E342), D350 (≠ E342), A351 (= A343), Q427 (vs. gap), K428 (vs. gap)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R18), I29 (≠ V28), M63 (≠ F62), H74 (≠ D73), W454 (= W426)
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
34% identity, 93% coverage: 4:507/541 of query aligns to 1:514/555 of 5brpA
- active site: D96 (= D99), Q196 (≠ R199), D198 (= D201), E249 (= E270), H323 (= H330), D324 (= D331)
- binding magnesium ion: D19 (= D22), T21 (≠ D24), N23 (≠ D26), V25 (= V28), D27 (= D30)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D61), N59 (≠ F62), Y61 (= Y64), H101 (= H104), Y162 (≠ F165), D198 (= D201), V199 (≠ A202), E249 (= E270)
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
34% identity, 97% coverage: 6:532/541 of query aligns to 6:549/559 of 4howA
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
34% identity, 97% coverage: 6:532/541 of query aligns to 6:549/559 of 4hphA
- active site: D99 (= D99), R198 (= R199), D200 (= D201), Q254 (≠ E270), H327 (= H330), D328 (= D331)
- binding calcium ion: D22 (= D22), N24 (≠ D24), D26 (= D26), I28 (≠ V28), D30 (= D30)
- binding beta-D-fructofuranose: F164 (= F165), Q254 (≠ E270), F256 (≠ S272), D328 (= D331), E387 (≠ T395), R415 (= R403)
- binding alpha-D-glucopyranose: D61 (= D61), Y64 (= Y64), H104 (= H104), F164 (= F165), D200 (= D201), Q254 (≠ E270), H327 (= H330), D328 (= D331), R415 (= R403)
Query Sequence
>N515DRAFT_3393 FitnessBrowser__Dyella79:N515DRAFT_3393
MSETPWWRGAVIYQIYPRSFLDTDGDGVGDLPGIVERLDYIAGLGVDAIWIAPFFRSPMA
DFGYDIADYRAVDPLFGTIDDFDRLLAKAHALGLKVMIDQVLSHTSDQHEWFKESRASRD
NPKADWYVWADARDDGTPPNNWMSLFGGVAWQWEPRRGQYYLHNFLTSQPDLNFHHPDVQ
RAVLDNVQFWLDKGVDGLRLDAINFCFHDRQLRDNPPKPQAMRVGRGFSPDNPYAFQYHY
YNNTQPENLAFLEELRGLLDRYPGAAALGEISSEDSLATMAEYTTGHRLHMGYSFELLTA
DFSAAYIRGTVERLEAQMTEGWPCWAISNHDVERVLSRWGREARGNGDASVRLANLLTAM
VCSLRGSVCVYQGEELALTEAEVPYEALQDPYGITFWPNFKGRDGCRTPMPWDESANAGF
SSGAPWLPVPAGHRALAVSRQELDPASALHGFRGFMQWRQAQPELRWGAIGFLDTPEPVL
AFTRTHAGETVLAAFNLGSAPVAVALPLAGERIGGHGLAEGTLEDGLLRLPPHGLLFARL
S
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory