SitesBLAST
Comparing N515DRAFT_3403 FitnessBrowser__Dyella79:N515DRAFT_3403 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
37% identity, 94% coverage: 2:332/352 of query aligns to 1:330/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
37% identity, 94% coverage: 3:332/352 of query aligns to 1:329/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y137), R144 (= R148), Q145 (≠ P149), Y146 (≠ F150), S147 (= S151), H161 (= H165), V162 (= V166), V165 (= V169), G168 (= G172), V169 (≠ G173), A170 (≠ F174), T171 (= T175), T214 (= T214), F329 (= F332)
- binding fe2/s2 (inorganic) cluster: C34 (= C36), N35 (≠ R37), G37 (= G39), C39 (= C41), G40 (= G42), C42 (= C44), C74 (= C76)
Sites not aligning to the query:
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
31% identity, 94% coverage: 1:332/352 of query aligns to 1:325/326 of Q03304
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
31% identity, 91% coverage: 11:332/352 of query aligns to 11:325/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C36), S38 (≠ A38), W57 (≠ Y55), Y135 (= Y137), R146 (= R148), A147 (≠ P149), Y148 (≠ F150), S149 (= S151), I162 (≠ H165), V163 (= V166), G169 (= G172), K170 (≠ G173), V171 (≠ F174), S172 (≠ T175), S209 (≠ T214), F325 (= F332)
- binding fe2/s2 (inorganic) cluster: Y34 (= Y34), C36 (= C36), N37 (≠ R37), G39 (= G39), C41 (= C41), G42 (= G42), C44 (= C44), C76 (= C76)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
27% identity, 91% coverage: 11:332/352 of query aligns to 15:334/337 of 1krhA
- active site: C306 (≠ S304)
- binding flavin-adenine dinucleotide: Y143 (= Y137), R155 (= R146), S156 (≠ R147), Y157 (≠ R148), S158 (≠ P149), V171 (≠ I162), V172 (= V166), G178 (= G172), K179 (≠ G173), M180 (≠ F174), S181 (≠ T175), T219 (= T214), E332 (≠ D330), F334 (= F332)
- binding fe2/s2 (inorganic) cluster: M38 (≠ Y34), D39 (≠ S35), C40 (= C36), R41 (= R37), G43 (= G39), C45 (= C41), G46 (= G42), C48 (= C44), C82 (= C76)
Sites not aligning to the query:
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 89% coverage: 19:332/352 of query aligns to 23:333/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
29% identity, 89% coverage: 19:332/352 of query aligns to 22:320/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C36), S41 (≠ A38), W60 (≠ Y55), R152 (= R148), A153 (≠ P149), Y154 (≠ F150), S155 (= S151), Y169 (≠ H165), I170 (≠ V166), G176 (= G172), R177 (≠ G173), F178 (= F174), S179 (≠ T175), A218 (≠ T214), F320 (= F332)
- binding fe2/s2 (inorganic) cluster: Y37 (= Y34), C39 (= C36), A40 (≠ R37), G42 (= G39), C44 (= C41), G45 (= G42), C47 (= C44), C80 (= C76)
Sites not aligning to the query:
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
28% identity, 89% coverage: 19:332/352 of query aligns to 22:305/306 of 7c3bB
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
28% identity, 66% coverage: 102:332/352 of query aligns to 11:244/250 of 1tvcA
- active site: Y63 (≠ F150), S64 (= S151), L215 (≠ M303)
- binding dihydroflavine-adenine dinucleotide: N24 (≠ D115), F49 (≠ Y137), R61 (= R148), S62 (≠ P149), Y63 (≠ F150), S64 (= S151), L78 (≠ H165), I79 (≠ V166), R80 (= R167), L82 (≠ V169), F87 (= F174), G128 (= G215), N155 (≠ R242), E159 (≠ D246), S186 (≠ E273), G187 (≠ Q274), E242 (≠ D330), F244 (= F332)
Sites not aligning to the query:
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
29% identity, 53% coverage: 148:332/352 of query aligns to 83:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: R83 (= R148), A84 (≠ P149), Y85 (≠ F150), S86 (= S151), N100 (≠ H165), A104 (vs. gap), S105 (vs. gap), L112 (≠ V169), P113 (≠ A170), G115 (= G172), Q116 (≠ G173), M117 (≠ F174), S118 (≠ T175), A155 (≠ T214), F278 (= F332)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R167), G154 (= G213), G182 (= G240), F226 (≠ L280), I227 (≠ R281), P252 (= P306), M255 (= M309)
Sites not aligning to the query:
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
29% identity, 53% coverage: 148:332/352 of query aligns to 83:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: R83 (= R148), A84 (≠ P149), Y85 (≠ F150), S86 (= S151), N100 (≠ H165), A104 (vs. gap), L112 (≠ V169), P113 (≠ A170), G115 (= G172), Q116 (≠ G173), M117 (≠ F174), S118 (≠ T175), A155 (≠ T214), F278 (= F332)
- binding gamma-Valerolactone: S105 (vs. gap), P108 (vs. gap), D196 (≠ R254), W207 (≠ F265), H208 (= H266), L209 (≠ P267)
Sites not aligning to the query:
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
29% identity, 59% coverage: 124:332/352 of query aligns to 57:279/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (= S270), F227 (≠ L280), M256 (= M309)
- binding flavin-adenine dinucleotide: R83 (= R148), A84 (≠ P149), Y85 (≠ F150), S86 (= S151), A104 (vs. gap), T105 (vs. gap), P106 (vs. gap), P107 (vs. gap), A113 (= A170), P114 (≠ G171), P115 (≠ G172), G116 (= G173), I117 (≠ F174), M118 (≠ T175), S119 (= S176), F279 (= F332)
Sites not aligning to the query:
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
29% identity, 59% coverage: 124:332/352 of query aligns to 57:279/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (= A241), R185 (= R242), S213 (= S270), F227 (≠ L280), H229 (≠ M282), V255 (≠ A308), M256 (= M309)
- binding flavin-adenine dinucleotide: R83 (= R148), A84 (≠ P149), Y85 (≠ F150), S86 (= S151), N100 (≠ H165), A104 (vs. gap), T105 (vs. gap), P107 (vs. gap), A113 (= A170), P114 (≠ G171), G116 (= G173), I117 (≠ F174), M118 (≠ T175), S119 (= S176), F279 (= F332)
Sites not aligning to the query:
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
30% identity, 45% coverage: 173:332/352 of query aligns to 125:288/289 of 2r6hC
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 86, 87, 88, 89, 103, 107, 108, 122, 123, 124
8a1uF Sodium pumping nadh-quinone oxidoreductase with substrates nadh and q2 (see paper)
28% identity, 53% coverage: 148:332/352 of query aligns to 209:405/405 of 8a1uF
- binding flavin-adenine dinucleotide: R209 (= R148), A210 (≠ P149), Y211 (≠ F150), S212 (= S151), A230 (vs. gap), P233 (vs. gap), V239 (= V169), P240 (≠ A170), G242 (= G172), Q243 (≠ G173), M244 (≠ F174), A282 (≠ T214), F405 (= F332)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S212 (= S151), R228 (= R167), G281 (= G213), A282 (≠ T214), G309 (= G240), R311 (= R242), S339 (= S270), F353 (≠ L280), C377 (≠ S304), G378 (= G305), P379 (= P306), M381 (≠ A308), M382 (= M309), D403 (= D330)
Sites not aligning to the query:
8a1yF Sodium pumping nadh-quinone oxidoreductase with inhibitor hqno (see paper)
28% identity, 53% coverage: 148:332/352 of query aligns to 210:406/408 of 8a1yF
- binding flavin-adenine dinucleotide: R210 (= R148), A211 (≠ P149), Y212 (≠ F150), S213 (= S151), V228 (= V166), R229 (= R167), A231 (vs. gap), V240 (= V169), P241 (≠ A170), G243 (= G172), Q244 (≠ G173), M245 (≠ F174)
Sites not aligning to the query:
A5F5Y4 Na(+)-translocating NADH-quinone reductase subunit F; Na(+)-NQR subunit F; Na(+)-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F; EC 7.2.1.1 from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) (see paper)
28% identity, 53% coverage: 148:332/352 of query aligns to 210:406/408 of A5F5Y4
- R210 (= R148) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- Y212 (≠ F150) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- S246 (≠ T175) mutation to A: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
Sites not aligning to the query:
- 70 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 76 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 79 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 111 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
4u9uA Crystal structure of nqrf fad-binding domain from vibrio cholerae (see paper)
28% identity, 53% coverage: 148:332/352 of query aligns to 81:277/279 of 4u9uA
- binding flavin-adenine dinucleotide: R81 (= R148), A82 (≠ P149), Y83 (≠ F150), S84 (= S151), N98 (≠ H165), A102 (vs. gap), T103 (vs. gap), P104 (vs. gap), V111 (= V169), P112 (≠ A170), G114 (= G172), Q115 (≠ G173), M116 (≠ F174), S117 (≠ T175), F277 (= F332)
- binding magnesium ion: R186 (≠ A245), M188 (≠ L247)
- binding sodium ion: A198 (≠ E257), N201 (≠ A260), D202 (≠ H261), F204 (≠ L263)
Sites not aligning to the query:
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
27% identity, 67% coverage: 105:341/352 of query aligns to 158:403/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R148), Q207 (≠ P149), Y208 (≠ F150), S209 (= S151), S222 (≠ H165), V223 (= V166), K224 (≠ R167), E226 (≠ V169), P232 (vs. gap), G234 (= G173), Y235 (≠ F174), V236 (≠ T175), S237 (= S176), V276 (≠ T214), T279 (≠ A217), V395 (≠ S331), F396 (= F332)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: P398 (= P336)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
27% identity, 67% coverage: 105:341/352 of query aligns to 158:403/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R148), Q207 (≠ P149), Y208 (≠ F150), S209 (= S151), S222 (≠ H165), V223 (= V166), K224 (≠ R167), E226 (≠ V169), P232 (vs. gap), G234 (= G173), Y235 (≠ F174), V236 (≠ T175), S237 (= S176), V276 (≠ T214), T279 (≠ A217), F396 (= F332)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
Query Sequence
>N515DRAFT_3403 FitnessBrowser__Dyella79:N515DRAFT_3403
MFTVTLKQSGRRFPVEPGETVLEAAQRAGIALPYSCRAGVCGSCKAILLEGQCQYPRNPP
VALSGTSPAQHAVLLCQAVPCGDLLIAAREVTSVEDIARRRLEVVVTEKSALAPDVIGLR
LEPAPGETRLNWLPGQYLDVLLEDGRRRPFSIAGGPRADGSIEMHVRHVAGGGFTSWVAD
GLRVGDRLRLEAPLGTFVPREDSERPMVFMAGGTGFAPVKAIVEHFLALGTRRPIEVYWG
ARNAADLYLLELARGWERSAHALRFHPVLSDPEQAAASGLRMGLVHEAVLEDLPDLSGHD
VYMSGPPAMIDAGRKLFLDAGLPEERLYYDSFDYAPDVLAQILAGRAGLAHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory