Comparing N515DRAFT_3530 FitnessBrowser__Dyella79:N515DRAFT_3530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 85% coverage: 41:417/446 of query aligns to 52:411/440 of O04373
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
37% identity, 87% coverage: 41:430/446 of query aligns to 20:389/389 of 4ewtA
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 84% coverage: 41:416/446 of query aligns to 14:363/380 of P54955
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
36% identity, 90% coverage: 28:429/446 of query aligns to 6:397/398 of 6slfA
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 86% coverage: 35:417/446 of query aligns to 46:415/442 of P54968
3ramA Crystal structure of hmra (see paper)
25% identity, 82% coverage: 44:407/446 of query aligns to 25:345/391 of 3ramA
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
23% identity, 60% coverage: 92:357/446 of query aligns to 70:310/373 of 3rzaA
Sites not aligning to the query:
>N515DRAFT_3530 FitnessBrowser__Dyella79:N515DRAFT_3530
MRHALLALSLATAIASAHASEHGVDAAQRIQGALPQVTAWRREIHQHPELSNRETRTAAL
VAAQLKKLGLEVRTGIAHTGVVGILKGGQPGPKLAIRADMDALPVTEEVDLPFASKAQGE
YRGKSTGVMHACGHDTHTAMLLGLATVLAGMRQELSGEVMFLFQPAEEGAPAGEQGGAPL
MLQEGVFRDFAPDAMFAMHVISTLNAGTVAVRPGPALSGADGFKLVVHGRQTHGAMPWHG
VDPIVTAAQIVTQAQTIVSRRLDIGTLPAVLSFGIVEGGARHNIVPDKVELQGTLRTFDP
AMRQQAIDGLRDIAEHVAAANGATVEAQIPMDGSVPVTVNEATLTARVRASLAKAIGGEQ
VLEAPPAMPSEDFAYFARAVPSVYFFVGATPAGQDPAKAPANHSPRFFVDEDALRVGMLS
MLQATLDYLQPPASGSAAIATRPSAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory