SitesBLAST
Comparing N515DRAFT_3549 N515DRAFT_3549 UDP-glucuronate 4-epimerase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
56% identity, 100% coverage: 1:336/336 of query aligns to 2:321/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (= N32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (= D61), L62 (= L62), L83 (= L83), A84 (= A84), A85 (= A85), A118 (= A125), Y145 (= Y152), K149 (= K156), F172 (= F179), F173 (= F180), T174 (= T181), V175 (= V182), R181 (= R188)
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
55% identity, 100% coverage: 1:335/336 of query aligns to 2:304/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (= N32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (= D61), L62 (= L62), L83 (= L83), A84 (= A84), A85 (= A85), A123 (= A125), Y150 (= Y152), K154 (= K156), F177 (= F179), V180 (= V182), R186 (= R188), M189 (= M191)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
32% identity, 100% coverage: 1:335/336 of query aligns to 1:315/321 of 6zllA
- active site: T126 (= T127), S127 (= S128), S128 (= S129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ L62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (= T127), Y149 (= Y152), K153 (= K156), Y176 (≠ F179), V179 (= V182), R185 (= R188), M188 (= M191)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A87), V87 (= V89), R88 (= R90), T126 (= T127), S127 (= S128), Y149 (= Y152), T178 (= T181), R185 (= R188), A189 (= A192), R192 (≠ L195), T204 (≠ R207), F206 (= F209), Q211 (≠ H214), R213 (= R216), I250 (≠ L270), E276 (≠ D296)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
32% identity, 99% coverage: 1:334/336 of query aligns to 1:314/314 of 6zldA
- active site: T126 (= T127), S127 (= S128), S128 (= S129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ L62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (= T127), K153 (= K156), Y176 (≠ F179), T178 (= T181), R185 (= R188), M188 (= M191)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A87), R88 (= R90), T126 (= T127), S127 (= S128), S128 (= S129), Y149 (= Y152), F177 (= F180), T178 (= T181), R185 (= R188), M188 (= M191), A189 (= A192), R192 (≠ L195), T204 (≠ R207), F206 (= F209), Q211 (≠ H214), R213 (= R216), I250 (≠ L270), E276 (≠ D296)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
32% identity, 99% coverage: 1:334/336 of query aligns to 1:314/314 of 6zl6A
- active site: T126 (= T127), S127 (= S128), S128 (= S129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ L62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (= T127), K153 (= K156), Y176 (≠ F179), T178 (= T181), V179 (= V182), R185 (= R188), M188 (= M191)
- binding uridine-5'-diphosphate: T178 (= T181), A189 (= A192), R192 (≠ L195), T204 (≠ R207), F206 (= F209), Q211 (≠ H214), R213 (= R216), I250 (≠ L270), E276 (≠ D296)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
31% identity, 99% coverage: 1:334/336 of query aligns to 1:314/314 of 6zljA
- active site: T126 (= T127), S127 (= S128), S128 (= S129), F149 (≠ Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ L62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (= T127), K153 (= K156), Y176 (≠ F179), T178 (= T181), V179 (= V182), R185 (= R188), M188 (= M191)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A87), R88 (= R90), T126 (= T127), S127 (= S128), S128 (= S129), F149 (≠ Y152), F177 (= F180), T178 (= T181), R185 (= R188), M188 (= M191), A189 (= A192), R192 (≠ L195), T204 (≠ R207), F206 (= F209), Q211 (≠ H214), R213 (= R216), I250 (≠ L270), E276 (≠ D296)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
30% identity, 99% coverage: 1:332/336 of query aligns to 1:306/309 of 4zrnA
- active site: T117 (= T127), G119 (≠ S128), A120 (≠ S129), Y143 (= Y152), K147 (= K156), Y181 (vs. gap), G185 (≠ M191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), S34 (≠ N34), S35 (≠ D35), G36 (≠ Y36), S51 (≠ A51), I52 (≠ L62), L73 (= L83), A74 (= A84), A75 (= A85), T92 (≠ S102), S115 (≠ A125), S116 (= S126), Y143 (= Y152), K147 (= K156), Y170 (≠ F179), V173 (= V182)
- binding uridine-5'-diphosphate-glucose: T117 (= T127), G119 (≠ S128), A120 (≠ S129), Y143 (= Y152), N172 (≠ T181), G185 (≠ M191), V186 (≠ A192), H201 (≠ R207), F203 (= F209), Y208 (≠ H214), R210 (= R216), V244 (≠ L270), R267 (≠ Q293), D270 (= D296)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
30% identity, 99% coverage: 4:335/336 of query aligns to 23:344/345 of Q7BJX9
- GVAGFI 26:31 (≠ GTAGFI 7:12) binding
- DNFSTG 50:55 (≠ DNLNDY 31:36) binding
- DI 81:82 (≠ DL 61:62) binding
- QAA 101:103 (≠ LAA 83:85) binding
- T120 (≠ S102) binding
- SS 145:146 (≠ TS 127:128) binding
- S147 (= S129) mutation to T: No effect on epimerase activity.
- Y169 (= Y152) binding
- K173 (= K156) binding
- YFN 196:198 (≠ FFT 179:181) binding
- V199 (= V182) binding
- VIPK 213:216 (≠ -LFL 193:195) binding
- YIN 228:230 (≠ RVF 207:209) binding
- S236 (≠ K215) mutation to G: No effect on epimerase activity.
- R237 (= R216) binding
- R271 (≠ P249) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ QAGD 293:296) binding
- R307 (≠ P298) mutation to A: No effect on epimerase activity.
- H308 (≠ E299) mutation to A: No effect on epimerase activity.
- S309 (≠ T300) mutation to Y: Abolishes epimerase activity.
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 99% coverage: 4:335/336 of query aligns to 20:336/336 of 3ruhA
- active site: S142 (≠ T127), S143 (= S128), S144 (= S129), Y166 (= Y152), K170 (= K156), N204 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (= D61), I79 (≠ L62), Q98 (≠ L83), A99 (= A84), A100 (= A85), T117 (≠ S102), A140 (= A125), A141 (≠ S126), S142 (≠ T127), Y166 (= Y152), K170 (= K156), Y193 (≠ F179), V196 (= V182)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A87), S103 (≠ G88), S142 (≠ T127), S143 (= S128), S144 (= S129), Y166 (= Y152), Y193 (≠ F179), N195 (≠ T181), A209 (vs. gap), V210 (vs. gap), K213 (≠ L195), W214 (≠ F196), Y225 (≠ R207), I226 (≠ V208), N227 (≠ F209), R234 (= R216), L271 (≠ S252), R294 (≠ Q293), D297 (= D296), V298 (= V297), S301 (≠ T300)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 99% coverage: 4:335/336 of query aligns to 20:336/336 of 3rufA
- active site: S142 (≠ T127), S143 (= S128), S144 (= S129), Y166 (= Y152), K170 (= K156), N204 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (= D61), I79 (≠ L62), Q98 (≠ L83), A99 (= A84), A100 (= A85), T117 (≠ S102), A140 (= A125), Y166 (= Y152), K170 (= K156), Y193 (≠ F179), V196 (= V182)
- binding uridine-5'-diphosphate: N195 (≠ T181), A209 (vs. gap), V210 (vs. gap), K213 (≠ L195), W214 (≠ F196), Y225 (≠ R207), I226 (≠ V208), N227 (≠ F209), R234 (= R216), L271 (≠ S252), R294 (≠ Q293), D297 (= D296)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
30% identity, 99% coverage: 4:335/336 of query aligns to 20:336/336 of 3lu1A
- active site: S142 (≠ T127), S143 (= S128), S144 (= S129), Y166 (= Y152), K170 (= K156), N204 (≠ D190)
- binding glycine: Q135 (= Q120), K187 (≠ P173)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (= D61), I79 (≠ L62), Q98 (≠ L83), A99 (= A84), A100 (= A85), A140 (= A125), A141 (≠ S126), S142 (≠ T127), Y166 (= Y152), K170 (= K156), Y193 (≠ F179), N195 (≠ T181)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G88), S142 (≠ T127), S143 (= S128), S144 (= S129), Y166 (= Y152), N195 (≠ T181), V210 (vs. gap), W214 (≠ F196), Y225 (≠ R207), I226 (≠ V208), N227 (≠ F209), R234 (= R216), L271 (≠ S252), R294 (≠ Q293), D297 (= D296)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
32% identity, 99% coverage: 1:331/336 of query aligns to 1:308/311 of 2p5uA
- active site: T117 (= T127), G119 (≠ S128), A120 (≠ S129), Y143 (= Y152), K147 (= K156), H181 (≠ D190), G185 (≠ M191)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (= L33), A34 (= A44), T35 (≠ R45), G36 (≠ L46), D51 (= D61), L52 (= L62), Q73 (≠ L83), A74 (= A84), A75 (= A85), A77 (= A87), S116 (= S126), Y143 (= Y152), K147 (= K156), V173 (= V182)
3aw9A Structure of udp-galactose 4-epimerase mutant
30% identity, 96% coverage: 1:323/336 of query aligns to 1:293/304 of 3aw9A
- active site: A105 (= A125), S107 (≠ T127), S108 (= S128), T109 (≠ S129), Y131 (= Y152), K135 (= K156), L166 (≠ G187), G169 (≠ D190)
- binding galactose-uridine-5'-diphosphate: P69 (≠ A87), V71 (= V89), S107 (≠ T127), Y131 (= Y152), N160 (≠ T181), H168 (≠ P189), V170 (≠ M191), D173 (≠ F194), L188 (≠ F209), Q193 (≠ H214), K195 (≠ R216), Y197 (≠ F218), V234 (≠ L270), W263 (vs. gap), D266 (= D296)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), I32 (≠ N32), R46 (vs. gap), D47 (= D61), L48 (= L62), F65 (≠ L83), A66 (= A84), A67 (= A85), E82 (≠ S102), A105 (= A125), S106 (= S126), Y131 (= Y152), K135 (= K156), Y158 (≠ F179), N160 (≠ T181), V161 (= V182), H168 (≠ P189)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
28% identity, 98% coverage: 2:330/336 of query aligns to 5:337/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D31), A37 (≠ N32), L38 (= L33), T39 (≠ N34), G42 (≠ V39), D62 (= D61), I63 (≠ L62), L84 (= L83), A85 (= A84), A86 (= A85), T103 (≠ S102), S143 (= S126), T144 (= T127), Y169 (= Y152), K173 (= K156), C196 (≠ F179)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
29% identity, 99% coverage: 1:332/336 of query aligns to 1:313/322 of 1r6dA
- active site: T127 (= T127), N128 (≠ S128), Q129 (≠ S129), Y151 (= Y152), K155 (= K156)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ A87), H88 (≠ G88), T127 (= T127), N128 (≠ S128), Q129 (≠ S129), Y151 (= Y152), N180 (≠ T181), K190 (≠ M191), L191 (≠ A192), P206 (≠ R207), Y208 (≠ F209), R215 (= R216), N250 (≠ L270), R274 (≠ Q293), H277 (≠ D296), Y281 (≠ T300)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D31), S38 (≠ N32), L39 (= L33), T40 (≠ N34), A42 (≠ G40), G43 (≠ L41), D63 (= D61), I64 (≠ L62), F83 (≠ L83), A84 (= A84), A85 (= A85), S87 (≠ A87), T102 (≠ S102), V125 (≠ A125), S126 (= S126), Y151 (= Y152), K155 (= K156), N181 (≠ V182)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
29% identity, 99% coverage: 1:332/336 of query aligns to 1:313/322 of 1r66A
- active site: T127 (= T127), D128 (≠ S128), E129 (≠ S129), Y151 (= Y152), K155 (= K156)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D31), S38 (≠ N32), L39 (= L33), T40 (≠ N34), G43 (≠ L41), D63 (= D61), I64 (≠ L62), F83 (≠ L83), A84 (= A84), A85 (= A85), S87 (≠ A87), T102 (≠ S102), V125 (≠ A125), S126 (= S126), Y151 (= Y152), K155 (= K156), N181 (≠ V182)
- binding thymidine-5'-diphosphate: H88 (≠ G88), E129 (≠ S129), N180 (≠ T181), K190 (≠ M191), L191 (≠ A192), P206 (≠ R207), Y208 (≠ F209), R215 (= R216), N250 (≠ L270), R274 (≠ Q293), H277 (≠ D296)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
28% identity, 99% coverage: 1:331/336 of query aligns to 1:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A87), R84 (= R90), S121 (≠ T127), G123 (vs. gap), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), A187 (vs. gap), G188 (vs. gap), V189 (≠ A192), F193 (= F196), R204 (= R207), F206 (= F209), N211 (≠ D233), R213 (≠ V235), D248 (≠ L270), R271 (≠ Q293)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), A34 (≠ D38), T35 (≠ V39), G36 (= G40), D56 (= D61), I57 (≠ L62), L77 (= L83), A78 (= A84), A79 (= A85), I81 (≠ A87), T119 (≠ A125), Y146 (= Y152), K150 (= K156), P173 (≠ F179), A174 (≠ F180), V176 (= V182)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A87), R84 (= R90), S121 (≠ T127), G123 (vs. gap), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), A187 (vs. gap), G188 (vs. gap), V189 (≠ A192), F193 (= F196), R204 (= R207), F206 (= F209), N211 (≠ D233), R213 (≠ V235), D248 (≠ L270), R271 (≠ Q293)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
28% identity, 99% coverage: 1:331/336 of query aligns to 1:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), T35 (≠ V39), G36 (= G40), D56 (= D61), I57 (≠ L62), L77 (= L83), A78 (= A84), A79 (= A85), I81 (≠ A87), T119 (≠ A125), Y146 (= Y152), K150 (= K156), P173 (≠ F179), N175 (≠ T181), V176 (= V182)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A87), R84 (= R90), S121 (≠ T127), G123 (vs. gap), S124 (= S129), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), G188 (vs. gap), V189 (≠ A192), F193 (= F196), R204 (= R207), V205 (= V208), F206 (= F209), N211 (≠ D233), R213 (≠ V235), D248 (≠ L270), R271 (≠ Q293)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
28% identity, 99% coverage: 1:331/336 of query aligns to 1:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), T35 (≠ V39), G36 (= G40), D56 (= D61), I57 (≠ L62), L77 (= L83), A78 (= A84), A79 (= A85), I81 (≠ A87), V96 (≠ S102), T119 (≠ A125), Y146 (= Y152), K150 (= K156), P173 (≠ F179), A174 (≠ F180), N175 (≠ T181), V176 (= V182)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A87), R84 (= R90), S121 (≠ T127), G123 (vs. gap), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), A187 (vs. gap), G188 (vs. gap), V189 (≠ A192), F193 (= F196), R204 (= R207), V205 (= V208), F206 (= F209), R213 (≠ V235), D248 (≠ L270), R271 (≠ Q293)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
28% identity, 99% coverage: 4:335/336 of query aligns to 19:340/340 of 1sb9A
- active site: S141 (≠ T127), S142 (= S128), S143 (= S129), Y165 (= Y152), K169 (= K156), N203 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G22 (= G7), G25 (= G10), F26 (= F11), I27 (= I12), D46 (= D31), N47 (= N32), F48 (≠ L33), T50 (≠ D35), G51 (≠ Y36), D77 (= D61), I78 (≠ L62), Q97 (≠ L83), A99 (= A85), T116 (≠ S102), A139 (= A125), A140 (≠ S126), Y165 (= Y152), K169 (= K156), Y192 (≠ F179), N194 (≠ T181), V195 (= V182)
- binding uridine-5'-diphosphate-glucose: S141 (≠ T127), Y165 (= Y152), N194 (≠ T181), A208 (vs. gap), V209 (vs. gap), W213 (≠ F196), Y224 (≠ R207), I225 (≠ V208), N226 (≠ F209), L270 (= L270), R298 (≠ Q293), D301 (= D296)
Query Sequence
>N515DRAFT_3549 N515DRAFT_3549 UDP-glucuronate 4-epimerase
MKVLVTGTAGFIGSHVARKLLARGDEVIGLDNLNDYYDVGLKQARLARVQAYPGYTHVHA
DLADRAAVEKLFATHKPERVVNLAAQAGVRYAATNPHVYVSSNVTGFLHILEGCRQHGVQ
HLVFASTSSVYGANRDLPFSEHRPAEHPLTLYAATKKANEQMAHSYAHLYGVPATGLRFF
TVYGPWGRPDMALFLFTKAILAGEPIRVFNEGRHKRSFTYIDDIVEGVVRALDTVPGKDP
AWDATQPDPSTSGVAPYRLYNIGNEQPVELLRYIEVLEQCLGRKATMELLPLQAGDVPET
EADVSSLVAAVGYRPKVSVEEGIAAFVKWYREYFKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory