Comparing N515DRAFT_3630 FitnessBrowser__Dyella79:N515DRAFT_3630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O58478 Alanine/serine racemase; ASR; Ala/Ser racemase; EC 5.1.1.-; EC 5.1.1.1 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
31% identity, 95% coverage: 17:462/469 of query aligns to 34:458/474 of O58478
2eo5A Crystal structure of 4-aminobutyrate aminotransferase from sulfolobus tokodaii strain7
32% identity, 91% coverage: 38:462/469 of query aligns to 25:409/412 of 2eo5A
Sites not aligning to the query:
O50131 Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
32% identity, 90% coverage: 40:462/469 of query aligns to 39:442/454 of O50131
7vo1A Structure of aminotransferase-substrate complex (see paper)
32% identity, 90% coverage: 40:462/469 of query aligns to 37:440/452 of 7vo1A
7vntA Structure of aminotransferase-substrate complex (see paper)
32% identity, 90% coverage: 40:462/469 of query aligns to 37:440/452 of 7vntA
7vnoA Structure of aminotransferase (see paper)
32% identity, 90% coverage: 40:462/469 of query aligns to 37:440/452 of 7vnoA
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
29% identity, 91% coverage: 30:455/469 of query aligns to 12:436/448 of 6io1B
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
30% identity, 89% coverage: 39:455/469 of query aligns to 34:446/458 of 3fcrA
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
27% identity, 92% coverage: 30:460/469 of query aligns to 12:446/453 of 6s54A
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
29% identity, 90% coverage: 37:456/469 of query aligns to 33:447/458 of 3gjuA
Sites not aligning to the query:
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
26% identity, 92% coverage: 36:465/469 of query aligns to 25:448/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
26% identity, 92% coverage: 36:465/469 of query aligns to 23:446/447 of 5lhaA
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
28% identity, 91% coverage: 38:462/469 of query aligns to 19:390/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
28% identity, 91% coverage: 38:462/469 of query aligns to 11:382/385 of Q9X2A5
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
27% identity, 91% coverage: 37:462/469 of query aligns to 33:453/460 of 5kr6B
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
26% identity, 96% coverage: 16:463/469 of query aligns to 15:439/448 of 4ysnC
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
27% identity, 90% coverage: 42:463/469 of query aligns to 27:420/421 of P50457
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
26% identity, 96% coverage: 16:463/469 of query aligns to 6:430/439 of 5wyaA
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
26% identity, 92% coverage: 38:467/469 of query aligns to 23:425/425 of 1szkA
Sites not aligning to the query:
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
26% identity, 96% coverage: 16:463/469 of query aligns to 8:432/446 of 5wyfA
>N515DRAFT_3630 FitnessBrowser__Dyella79:N515DRAFT_3630
MNAYDPNAATGVIPDAQLLADEAQYSSFGDTVHYVDPPKIFRHGQGSWMYDTAGVPFLDL
QMWYSAVNFGYGNKRLNDTLKAQIDTLPQVASQYLHQTRIELAKTIAVDAQQKFGLKGRV
HFNVGGAQAVEDSLKLVRNYKNGKSLMFAFEGGYHGRTLGASSITSSYRYRRRFGHFGER
AMFIPFPYPFRRPKGMTPEEYSDACVRQFERLFETEYNGVWDPKVNQAEYAAFYVEPIQG
TGGYVIPPKNFFKDLKKVLDKYGILMVVDEIQMGFWRTGKLWSIEHFGVTPDIIVFGKAL
TNGLNPLSGLWAREEMINPEIFPPGSTHSTFNSNPLGTSLGLEVIKMGYELDYETNVAKK
GAHFLDALKDLQKRHKEIGDVDGLGLALRAEICTDDGFTPNKALLDRMVDIGLAGDLEHN
GKKIGLVLDVGGWYKNVITFAPSLDITHEEIDLAIALLDQLLTKAKKAM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory