Comparing N515DRAFT_3712 FitnessBrowser__Dyella79:N515DRAFT_3712 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3i6yA Structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
57% identity, 99% coverage: 4:281/281 of query aligns to 2:278/278 of 3i6yA
3s8yA Bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
56% identity, 99% coverage: 4:280/281 of query aligns to 2:277/277 of 3s8yA
3e4dA Structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens (see paper)
53% identity, 98% coverage: 4:279/281 of query aligns to 2:277/278 of 3e4dA
P10768 S-formylglutathione hydrolase; FGH; Esterase D; Methylumbelliferyl-acetate deacetylase; EC 3.1.2.12; EC 3.1.1.56 from Homo sapiens (Human) (see 4 papers)
53% identity, 99% coverage: 4:281/281 of query aligns to 3:282/282 of P10768
Q8LAS8 S-formylglutathione hydrolase; AtSFGH; Esterase D; EC 3.1.2.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
52% identity, 98% coverage: 7:280/281 of query aligns to 8:283/284 of Q8LAS8
3fcxB Crystal structure of human esterase d (see paper)
52% identity, 99% coverage: 4:280/281 of query aligns to 1:275/275 of 3fcxB
P33018 S-formylglutathione hydrolase YeiG; FGH; EC 3.1.2.12 from Escherichia coli (strain K12) (see paper)
54% identity, 98% coverage: 4:279/281 of query aligns to 1:276/278 of P33018
3fcxA Crystal structure of human esterase d (see paper)
52% identity, 99% coverage: 4:281/281 of query aligns to 3:268/268 of 3fcxA
P40363 S-formylglutathione hydrolase; FGH; EC 3.1.2.12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
39% identity, 98% coverage: 4:279/281 of query aligns to 1:296/299 of P40363
4flmA S-formylglutathione hydrolase w197i variant containing copper (see paper)
39% identity, 98% coverage: 4:279/281 of query aligns to 1:285/288 of 4flmA
P9WQP3 Diacylglycerol acyltransferase/mycolyltransferase Ag85A; DGAT; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; 85A; Ag85A; Fibronectin-binding protein A; Fbps A; EC 2.3.1.122; EC 2.3.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
27% identity, 51% coverage: 40:181/281 of query aligns to 70:200/338 of P9WQP3
>N515DRAFT_3712 FitnessBrowser__Dyella79:N515DRAFT_3712
MSEIEIVAEQRSFGGVQGFYRHVSETCGGPMRFAVYQPPQAATRACPVLYFLAGLTCTEE
TATIKAGAQRMAAELGLVLVMPDTSPRDTGIGGATGDWEFGEGAGFYVDATVAPWSARFR
MHSYVVDELPALLARQFPVDLARSGICGHSMGGHGALTIALKHPQRYRSVSAFAPIVAPT
QVPWGHKALPRYLGDDPAAWAAYDACELVREHSFDGEILIDQGEADKFLAEQLRPELFDQ
ACAESGQALRLRRHAGYDHSYYFIASFIEDHLRHHARALEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory