SitesBLAST
Comparing N515DRAFT_3723 FitnessBrowser__Dyella79:N515DRAFT_3723 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 94% coverage: 5:399/419 of query aligns to 1:343/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L11), G8 (= G12), G10 (= G14), V11 (= V15), I12 (= I16), V30 (≠ L34), E31 (= E35), K32 (≠ Q36), E38 (≠ G42), A39 (≠ S43), S40 (= S44), A43 (≠ M61), G45 (= G63), L46 (≠ M64), V171 (≠ I226), G200 (≠ L255), G201 (= G256), W203 (= W258), G298 (= G354), R300 (= R356), P301 (= P357), Y326 (≠ G382), R327 (≠ M383), N328 (≠ L384), G329 (= G385), I330 (≠ V386)
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
28% identity, 71% coverage: 118:416/419 of query aligns to 67:367/370 of 4yshA
- active site: I262 (≠ L311), L283 (= L332), G305 (= G354), N335 (≠ L384), L338 (≠ S387)
- binding flavin-adenine dinucleotide: V178 (≠ I226), S206 (≠ L255), G207 (= G256), W209 (= W258), R307 (= R356), H332 (= H381), R334 (≠ M383), N335 (≠ L384), G336 (= G385), I337 (≠ V386)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
28% identity, 71% coverage: 118:416/419 of query aligns to 67:367/368 of 4yshB
- active site: I262 (≠ L311), L283 (= L332), G305 (= G354), N335 (≠ L384), L338 (≠ S387)
- binding flavin-adenine dinucleotide: V178 (≠ I226), S206 (≠ L255), W209 (= W258), R307 (= R356), H332 (= H381), R334 (≠ M383), N335 (≠ L384), G336 (= G385), I337 (≠ V386), L338 (≠ S387)
- binding glycine: G249 (≠ A298), Y251 (≠ V300), Y251 (≠ V300), A264 (≠ S313), R307 (= R356), R334 (≠ M383), R334 (≠ M383)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
28% identity, 71% coverage: 118:416/419 of query aligns to 68:369/377 of Q5L2C2
- V180 (≠ I226) binding
- R309 (= R356) binding
- 334:340 (vs. 381:387, 29% identical) binding
- R336 (≠ M383) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
20% identity, 74% coverage: 110:417/419 of query aligns to 57:368/374 of 1y56B
- active site: H224 (≠ G277), P239 (≠ A292), G305 (= G354), M338 (≠ S387)
- binding flavin-adenine dinucleotide: E170 (≠ R225), V171 (≠ I226), T200 (≠ L255), N201 (≠ G256), W203 (= W258), G305 (= G354), Y306 (≠ W355), Y307 (≠ R356), G334 (≠ M383), H335 (≠ L384), G336 (= G385), F337 (≠ V386), M338 (≠ S387)
- binding flavin mononucleotide: I260 (vs. gap), R301 (≠ E350), W303 (= W352)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
27% identity, 59% coverage: 152:399/419 of query aligns to 102:345/369 of S5FMM4
- S202 (≠ L255) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V386) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V396) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
25% identity, 63% coverage: 8:272/419 of query aligns to 28:241/824 of Q8GAI3
- W66 (≠ H45) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H55) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
24% identity, 54% coverage: 175:399/419 of query aligns to 123:345/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ R225), V174 (≠ I226), S202 (≠ L255), G203 (= G256), W205 (= W258), F209 (≠ L262), G300 (= G354), R302 (= R356), H327 (= H381), F328 (≠ G382), R329 (≠ M383), N330 (≠ L384), G331 (= G385), I332 (≠ V386)
- binding glycolic acid: Y246 (≠ V300), R302 (= R356), R329 (≠ M383)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
6j39A Crystal structure of cmis2 with inhibitor (see paper)
28% identity, 60% coverage: 165:417/419 of query aligns to 114:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ C301), Y252 (≠ R310), Y267 (≠ M315), R308 (= R356), R334 (≠ M383), I335 (≠ L384)
- binding flavin-adenine dinucleotide: A174 (≠ I226), A203 (≠ L255), W206 (= W258), I228 (≠ S279), Y252 (≠ R310), R308 (= R356), S333 (≠ G382), R334 (≠ M383), I335 (≠ L384), G336 (= G385), V337 (= V386), Q338 (≠ S387)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
28% identity, 60% coverage: 165:417/419 of query aligns to 114:368/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ I226), A203 (≠ L255), W206 (= W258), G226 (= G277), G306 (= G354), R308 (= R356), S333 (≠ G382), R334 (≠ M383), I335 (≠ L384), G336 (= G385), V337 (= V386), Q338 (≠ S387)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
24% identity, 55% coverage: 169:399/419 of query aligns to 117:345/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V300), R302 (= R356), R329 (≠ M383)
- binding flavin-adenine dinucleotide: V174 (≠ I226), S202 (≠ L255), G203 (= G256), W205 (= W258), F209 (≠ L262), G300 (= G354), R302 (= R356), H327 (= H381), R329 (≠ M383), N330 (≠ L384), G331 (= G385), I332 (≠ V386)
- binding phosphate ion: R254 (≠ G308)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
24% identity, 55% coverage: 169:399/419 of query aligns to 117:345/369 of O31616
- V174 (≠ I226) binding
- H244 (≠ A298) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R356) binding
- 327:333 (vs. 381:387, 29% identical) binding
- R329 (≠ M383) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3qseA Crystal structure for the complex of substrate-reduced msox with sarcosine (see paper)
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 3qseA
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding chloride ion: Y317 (≠ R356), F342 (≠ H381)
- binding flavin-adenine dinucleotide: G10 (= G12), S13 (≠ V15), M14 (≠ I16), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), V173 (≠ I226), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
- binding sarcosine: I50 (≠ T50), R52 (≠ T52), M245 (≠ A299), Y254 (vs. gap), H269 (vs. gap), G344 (≠ M383), H345 (≠ L384), K348 (≠ S387)
2gf3A Structure of the complex of monomeric sarcosine with its substrate analogue inhibitor 2-furoic acid at 1.3 a resolution.
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 2gf3A
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding flavin-adenine dinucleotide: G10 (= G12), S13 (≠ V15), M14 (≠ I16), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), G42 (= G42), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), R172 (= R225), V173 (≠ I226), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
- binding 2-furoic acid: I50 (≠ T50), R52 (≠ T52), P217 (= P271), Q219 (= Q273), Y221 (≠ G275), M245 (≠ A299), Y254 (vs. gap), K319 (≠ M358), T320 (≠ S359), L321 (≠ M360), H345 (≠ L384), K348 (≠ S387)
2a89A Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme (see paper)
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 2a89A
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding (n5,c4a)-(alpha-hydroxy-propano)-3,4,4a,5-tetrahydro-flavin-adenine dinucleotide: G10 (= G12), S13 (≠ V15), M14 (≠ I16), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), G42 (= G42), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), R172 (= R225), V173 (≠ I226), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), F256 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
1eliA Complex of monomeric sarcosine oxidase with the inhibitor pyrrole-2- carboxylate (see paper)
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 1eliA
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), S13 (≠ V15), M14 (≠ I16), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), G42 (= G42), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), R172 (= R225), V173 (≠ I226), S200 (≠ A254), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), F342 (≠ H381), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
- binding pyrrole-2-carboxylate: R52 (≠ T52), M245 (≠ A299), Y254 (vs. gap), H269 (vs. gap), G344 (≠ M383), H345 (≠ L384), K348 (≠ S387)
1el9A Complex of monomeric sarcosine oxidase with the inhibitor [methylthio]acetate (see paper)
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 1el9A
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding flavin-adenine dinucleotide: G10 (= G12), S13 (≠ V15), M14 (≠ I16), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), G42 (= G42), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), R172 (= R225), V173 (≠ I226), S200 (≠ A254), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
- binding [methylthio]acetate: I50 (≠ T50), R52 (≠ T52), M245 (≠ A299), Y254 (vs. gap), H269 (vs. gap), G344 (≠ M383), K348 (≠ S387)
1el8A Complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate (see paper)
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 1el8A
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding flavin-adenine dinucleotide: G10 (= G12), S13 (≠ V15), M14 (≠ I16), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), G42 (= G42), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), R172 (= R225), V173 (≠ I226), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
- binding [methylseleno]acetate: I50 (≠ T50), R52 (≠ T52), M245 (≠ A299), Y254 (vs. gap), G344 (≠ M383), H345 (≠ L384), K348 (≠ S387)
1el7A Complex of monomeric sarcosine oxidase with the inhibitor [methytelluro]acetate (see paper)
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 1el7A
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding flavin-adenine dinucleotide: G10 (= G12), S13 (≠ V15), M14 (≠ I16), V32 (≠ L34), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), G42 (= G42), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), R172 (= R225), V173 (≠ I226), S200 (≠ A254), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), F342 (≠ H381), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
- binding [methyltelluro]acetate: I50 (≠ T50), R52 (≠ T52), M245 (≠ A299), Y254 (vs. gap), H269 (vs. gap), G344 (≠ M383), H345 (≠ L384), K348 (≠ S387)
1el5A Complex of monomeric sarcosine oxidase with the inhibitor dimethylglycine (see paper)
21% identity, 99% coverage: 3:416/419 of query aligns to 1:377/385 of 1el5A
- active site: H45 (= H45), T48 (≠ C48), R49 (≠ G49), R52 (≠ T52), S98 (≠ C134), Y254 (vs. gap), K265 (≠ R310), H269 (vs. gap), C315 (≠ V348), H345 (≠ L384), K348 (≠ S387)
- binding n,n-dimethylglycine: I50 (≠ T50), R52 (≠ T52), M245 (≠ A299), Y254 (vs. gap), H269 (vs. gap), G344 (≠ M383), H345 (≠ L384), K348 (≠ S387)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), S13 (≠ V15), M14 (≠ I16), V32 (≠ L34), D33 (≠ E35), A34 (≠ Q36), H39 (vs. gap), G42 (= G42), S43 (= S43), H44 (≠ S44), R49 (≠ G49), I50 (≠ T50), R172 (= R225), V173 (≠ I226), S200 (≠ A254), M201 (≠ L255), G202 (= G256), W204 (= W258), Y254 (vs. gap), C315 (≠ V348), M316 (≠ L349), Y317 (≠ R356), F342 (≠ H381), G344 (≠ M383), H345 (≠ L384), G346 (= G385), F347 (≠ V386), K348 (≠ S387)
Query Sequence
>N515DRAFT_3723 FitnessBrowser__Dyella79:N515DRAFT_3723
MDASRSDVLILGGGVIGLASAYYLLRAGATVRVLEQGTPGCGSSHGNCGTITPSHAAPLA
MPGMVSVALRSMFRADAPLYLNPRPDPERLRWLLGFARRCNWRDFERATRARSAILQRSR
GLLEALVRDEALDCEFVAGGELYVYRTRAQMEADERHHAQVLDRLGIEVNRLRGDEVENL
EPALLPGVAGGLFHPGDAQLRPNRYAAELARRVRELGGVIESGARIDQFGLQDGRISHVR
TTRGVFHGEQVVMALGAWSPLLGRLLDLRLPMQPGKGYSITYTRPQQAPRHALVLREAAV
CVTTWGSGYRLGSTMEFSGYAEGLNRTRLDALRRGAAAALREPEGPEVLEEWWGWRPMSM
DEVPIIGPSTRWSNLLLATAHGMLGVSMSAATGELVAALAGRGTAALDPAPYAPARFGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory