SitesBLAST
Comparing N515DRAFT_3724 FitnessBrowser__Dyella79:N515DRAFT_3724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D0VWY5 Glutathione amide reductase; GAR; EC 1.8.1.16 from Marichromatium gracile (Chromatium gracile) (see 2 papers)
51% identity, 100% coverage: 1:448/448 of query aligns to 1:448/463 of D0VWY5
- M1 (= M1) modified: Initiator methionine, Removed
- T2 (≠ A2) binding
- Q3 (≠ D3) binding
- H4 (≠ T4) binding
- SG 14:15 (= SG 14:15) binding
- E34 (≠ D34) binding
- T41 (= T41) binding
- C42 (= C42) modified: Disulfide link with 47, Redox-active
- C47 (= C47) modified: Disulfide link with 42, Redox-active
- K50 (= K50) binding ; binding
- HA 113:114 (≠ AG 113:114) binding
- 174:180 (vs. 175:181, 57% identical) binding
- LE 197:198 (≠ VR 197:198) binding
- V230 (≠ I230) binding
- G261 (= G261) binding
- D302 (= D302) binding
- Q308 (≠ A308) binding
- QLT 308:310 (≠ ALT 308:310) binding
- V341 (= V341) binding
- H437 (= H437) active site, Proton acceptor; binding
Sites not aligning to the query:
- 2:463 modified: mature protein, Glutathione amide reductase
2rabA Structure of glutathione amide reductase from chromatium gracile in complex with NAD (see paper)
52% identity, 99% coverage: 5:448/448 of query aligns to 4:444/451 of 2rabA
- active site: S13 (= S14), L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y173 (= Y177), E177 (= E181), I310 (≠ V314), A431 (= A435), H433 (= H437), E438 (= E442)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), I32 (≠ L33), E33 (≠ D34), S34 (≠ P35), T40 (= T41), G45 (= G46), C46 (= C47), K49 (= K50), H110 (≠ A113), A111 (≠ G114), T135 (= T139), G136 (= G140), R258 (= R262), G297 (= G301), D298 (= D302), Q304 (≠ A308), L305 (= L309), T306 (= T310)
- binding nicotinamide-adenine-dinucleotide: K49 (= K50), I169 (≠ V173), G172 (= G176), Y173 (= Y177), I174 (= I178), E177 (= E181), A193 (≠ H196), L194 (≠ V197), E195 (≠ R198), V227 (≠ I230), V256 (≠ L260), G257 (= G261), Q304 (≠ A308), V337 (= V341)
2r9zB Glutathione amide reductase from chromatium gracile (see paper)
51% identity, 99% coverage: 5:448/448 of query aligns to 4:446/453 of 2r9zB
- active site: S13 (= S14), L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), G74 (= G76), Y174 (= Y177), E178 (= E181), I312 (≠ V314), A433 (= A435), H435 (= H437), E440 (= E442)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), I32 (≠ L33), E33 (≠ D34), S34 (≠ P35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H111 (≠ A113), A112 (≠ G114), T136 (= T139), G137 (= G140), I175 (= I178), R260 (= R262), G299 (= G301), D300 (= D302), Q306 (≠ A308), L307 (= L309), T308 (= T310)
5vdnA 1.55 angstrom resolution crystal structure of glutathione reductase from yersinia pestis in complex with fad
49% identity, 99% coverage: 5:447/448 of query aligns to 4:448/449 of 5vdnA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y177), E180 (= E181), A436 (= A435), H438 (= H437), E443 (= E442)
- binding beta-D-fructopyranose: K35 (≠ G36), T40 (= T41), G140 (≠ A141), D157 (= D158)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G12 (= G13), S13 (= S14), G14 (= G15), E33 (≠ D34), A34 (≠ P35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), F113 (≠ A113), A114 (≠ G114), T138 (= T139), G139 (= G140), Y176 (= Y177), I177 (= I178), R262 (= R262), G301 (= G301), D302 (= D302), E308 (≠ A308), L309 (= L309), T310 (= T310)
P06715 Glutathione reductase; GR; GRase; EC 1.8.1.7 from Escherichia coli (strain K12) (see paper)
48% identity, 100% coverage: 1:447/448 of query aligns to 1:449/450 of P06715
- C42 (= C42) modified: Disulfide link with 47, Redox-active
- C47 (= C47) modified: Disulfide link with 42, Redox-active
1gerB The structure of glutathione reductase from escherichia coli at 1.86 angstroms resolution: comparison with the enzyme from human erythrocytes (see paper)
48% identity, 95% coverage: 22:447/448 of query aligns to 21:448/449 of 1gerB
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y177), E180 (= E181), A436 (= A435), H438 (= H437), E443 (= E442)
- binding flavin-adenine dinucleotide: E33 (≠ D34), A34 (≠ P35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), F113 (≠ A113), A114 (≠ G114), T138 (= T139), Y176 (= Y177), I177 (= I178), R262 (= R262), G301 (= G301), D302 (= D302), E308 (≠ A308), L309 (= L309), T310 (= T310)
Sites not aligning to the query:
1getA Anatomy of an engineered NAD-binding site (see paper)
48% identity, 95% coverage: 22:447/448 of query aligns to 20:447/448 of 1getA
- active site: L36 (= L38), C40 (= C42), C45 (= C47), K48 (= K50), Y175 (= Y177), E179 (= E181), A435 (= A435), H437 (= H437), E442 (= E442)
- binding flavin-adenine dinucleotide: E32 (≠ D34), A33 (≠ P35), G38 (= G40), T39 (= T41), C40 (= C42), G44 (= G46), C45 (= C47), K48 (= K50), F112 (≠ A113), A113 (≠ G114), T137 (= T139), I176 (= I178), R261 (= R262), G300 (= G301), D301 (= D302), E307 (≠ A308), L308 (= L309), T309 (= T310)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A173 (≠ G175), G174 (= G176), Y175 (= Y177), I176 (= I178), E179 (= E181), R196 (= R198), R202 (= R203), I259 (≠ L260), G260 (= G261), E307 (≠ A308), L308 (= L309), V340 (= V341)
Sites not aligning to the query:
6n7fA 1.90 angstrom resolution crystal structure of glutathione reductase from streptococcus pyogenes in complex with fad.
47% identity, 100% coverage: 1:447/448 of query aligns to 2:450/451 of 6n7fA
- active site: C43 (= C42), C48 (= C47), K51 (= K50), Y178 (= Y177), E182 (= E181), H440 (= H437), E445 (= E442)
- binding flavin-adenine dinucleotide: I11 (≠ L10), G12 (= G11), G14 (= G13), S15 (= S14), A16 (≠ G15), A34 (≠ L33), E35 (≠ D34), G36 (≠ P35), K37 (≠ G36), G41 (= G40), T42 (= T41), C43 (= C42), G47 (= G46), C48 (= C47), K51 (= K50), Y115 (≠ A113), A116 (≠ G114), T140 (= T139), G141 (= G140), Y178 (= Y177), I179 (= I178), R264 (= R262), G303 (= G301), D304 (= D302), L311 (= L309), T312 (= T310)
- binding riboflavin: G36 (≠ P35), K37 (≠ G36), Y115 (≠ A113), G270 (≠ R268)
5grtA Human glutathione reductase a34e, r37w mutant, glutathionylspermidine complex (see paper)
44% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 5grtA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G12 (= G13), G14 (= G15), V32 (≠ L33), E33 (≠ D34), S34 (≠ P35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), Y180 (= Y177), G313 (= G301), D314 (= D302), L320 (≠ A308), L321 (= L309), T322 (= T310)
- binding glutathionylspermidine disulfide: S13 (= S14), E17 (≠ A18), C41 (= C42), V42 (= V43), Y89 (= Y90), L93 (≠ I94), I96 (≠ R97), Y97 (= Y98), T322 (= T310), I326 (≠ V314)
4grtA Human glutathione reductase a34e, r37w mutant, mixed disulfide between trypanothione and the enzyme (see paper)
44% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 4grtA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), G11 (≠ A12), G12 (= G13), S13 (= S14), G14 (= G15), V32 (≠ L33), E33 (≠ D34), S34 (≠ P35), H35 (≠ G36), G39 (= G40), T40 (= T41), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G301), D314 (= D302), L320 (≠ A308), L321 (= L309), T322 (= T310), A325 (= A313)
- binding bis(gamma-glutamyl-cysteinyl-glycinyl)spermidine: S13 (= S14), L16 (= L17), E17 (≠ A18), C41 (= C42), V42 (= V43), V47 (= V48), L93 (≠ I94), Y97 (= Y98), I326 (≠ V314)
3grtA Human glutathione reductase a34e, r37w mutant, oxidized trypanothione complex (see paper)
44% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 3grtA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), V32 (≠ L33), E33 (≠ D34), S34 (≠ P35), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G301), D314 (= D302), L321 (= L309), T322 (= T310)
- binding 2-amino-4-[4-(4-amino-4-carboxy-butyrylamino)-5,8,19,22-tetraoxo-1,2-dithia-6,9,13,18,21-pentaaza-cyclotetracos-23-ylcarbamoyl]-butyric acid: S13 (= S14), E17 (≠ A18), W20 (≠ F21), V42 (= V43), L93 (≠ I94), Y97 (= Y98), T322 (= T310), I326 (≠ V314)
2grtA Human glutathione reductase a34e, r37w mutant, oxidized glutathione complex (see paper)
44% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 2grtA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G12 (= G13), S13 (= S14), G14 (= G15), E33 (≠ D34), S34 (≠ P35), G39 (= G40), T40 (= T41), C41 (= C42), V44 (= V45), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G301), D314 (= D302), L321 (= L309), T322 (= T310)
- binding oxidized glutathione disulfide: E17 (≠ A18), W20 (≠ F21), V42 (= V43), L93 (≠ I94), I96 (≠ R97), Y97 (= Y98)
1geuA Anatomy of an engineered NAD-binding site (see paper)
47% identity, 95% coverage: 22:447/448 of query aligns to 20:447/448 of 1geuA
- active site: L36 (= L38), C40 (= C42), C45 (= C47), K48 (= K50), Y175 (= Y177), E179 (= E181), A435 (= A435), H437 (= H437), E442 (= E442)
- binding flavin-adenine dinucleotide: E32 (≠ D34), A33 (≠ P35), K34 (≠ G36), G38 (= G40), T39 (= T41), C40 (= C42), G44 (= G46), C45 (= C47), K48 (= K50), F112 (≠ A113), A113 (≠ G114), T137 (= T139), G300 (= G301), D301 (= D302), L308 (= L309), T309 (= T310)
- binding nicotinamide-adenine-dinucleotide: Y175 (= Y177), I176 (= I178), E179 (= E181), E195 (≠ H196), M196 (≠ V197), F197 (≠ R198), A258 (= A259), I259 (≠ L260), G260 (= G261), E307 (≠ A308), L308 (= L309), V340 (= V341)
Sites not aligning to the query:
3djjA Catalytic cycle of human glutathione reductase near 1 a resolution (see paper)
45% identity, 99% coverage: 4:447/448 of query aligns to 4:461/462 of 3djjA
- active site: L38 (= L38), C42 (= C42), C47 (= C47), K50 (= K50), Y181 (= Y177), E185 (= E181), A449 (= A435), H451 (= H437), E456 (= E442)
- binding flavin-adenine dinucleotide: G13 (= G13), E34 (≠ D34), S35 (≠ P35), G40 (= G40), T41 (= T41), G46 (= G46), C47 (= C47), K50 (= K50), H113 (≠ A113), A114 (≠ G114), T140 (= T139), G141 (= G140), R275 (= R262), G314 (= G301), D315 (= D302), L321 (≠ A308), L322 (= L309), T323 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A179 (≠ G175), G180 (= G176), Y181 (= Y177), I182 (= I178), E185 (= E181), R202 (= R198), R208 (= R203), I273 (≠ L260), G274 (= G261), L321 (≠ A308), V354 (= V341)
4gr1A The binding of the retro-analogue of glutathione disulfide to glutathione reductase (see paper)
45% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 4gr1A
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), E33 (≠ D34), S34 (≠ P35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G301), D314 (= D302), L321 (= L309), T322 (= T310)
- binding 4n-malonyl-cysteinyl-2,4-diaminobutyrate disulfide: L93 (≠ I94), Y97 (= Y98), R330 (= R318)
3sqpA Structure of human glutathione reductase complexed with pyocyanin, an agent with antimalarial activity (see paper)
45% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 3sqpA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding 5-methylphenazin-1(5H)-one: V57 (≠ Q58), V57 (≠ Q58), H58 (≠ I59), F61 (≠ S62), F61 (≠ S62)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), E33 (≠ D34), S34 (≠ P35), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), Y180 (= Y177), R274 (= R262), G313 (= G301), D314 (= D302), L320 (≠ A308), L321 (= L309), T322 (= T310), P323 (= P311)
2gh5A Crystal structure of human glutathione reductase complexed with a fluoro-analogue of the menadione derivative m5 (see paper)
45% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 2gh5A
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding 6-(3-methyl-1,4-dioxo-1,4-dihydronaphthalen-2-yl)hexanoic acid: S13 (= S14), A17 (= A18), R20 (≠ F21), C41 (= C42), V42 (= V43), L93 (≠ I94), Y97 (= Y98)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), V32 (≠ L33), E33 (≠ D34), S34 (≠ P35), G39 (= G40), T40 (= T41), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), G140 (= G140), Y180 (= Y177), I181 (= I178), R274 (= R262), G313 (= G301), D314 (= D302), L320 (≠ A308), L321 (= L309), T322 (= T310)
2aaqA Crystal structure analysis of the human glutahione reductase, complexed with gopi (see paper)
45% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 2aaqA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding gold ion: C41 (= C42), C46 (= C47), T322 (= T310)
- binding 2-(2-phenyl-3-pyridin-2-yl-4,5,6,7-tetrahydro-2h-isophosphindol-1-yl)pyridine: L156 (= L153), I158 (≠ L155), G162 (≠ D159), L244 (≠ I240), D266 (= D254), C267 (≠ A255)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), G14 (= G15), V32 (≠ L33), E33 (≠ D34), S34 (≠ P35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), G140 (= G140), S160 (= S157), R274 (= R262), D314 (= D302), L321 (= L309), T322 (= T310)
1xanA Human glutathione reductase in complex with a xanthene inhibitor (see paper)
45% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 1xanA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), E33 (≠ D34), S34 (≠ P35), H35 (≠ G36), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), Y180 (= Y177), R274 (= R262), G313 (= G301), D314 (= D302), L320 (≠ A308), L321 (= L309), T322 (= T310)
- binding 3,6-dihydroxy-xanthene-9-propionic acid: V57 (≠ Q58), F61 (≠ S62), H65 (≠ A66), Y390 (≠ Q377)
1grbA Substrate binding and catalysis by glutathione reductase as derived from refined enzyme: substrate crystal structures at 2 angstroms resolution (see paper)
45% identity, 99% coverage: 4:447/448 of query aligns to 3:460/461 of 1grbA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A435), H450 (= H437), E455 (= E442)
- binding flavin-adenine dinucleotide: G12 (= G13), G14 (= G15), E33 (≠ D34), S34 (≠ P35), T40 (= T41), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ A113), A113 (≠ G114), T139 (= T139), G140 (= G140), G313 (= G301), D314 (= D302), L320 (≠ A308), L321 (= L309), T322 (= T310)
- binding nicotinamide-adenine-dinucleotide: K49 (= K50), A178 (≠ G175), G179 (= G176), Y180 (= Y177), I181 (= I178), E184 (= E181), R201 (= R198), A271 (= A259), I272 (≠ L260), G273 (= G261), L320 (≠ A308), V353 (= V341)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K49 (= K50), A178 (≠ G175), G179 (= G176), Y180 (= Y177), I181 (= I178), E184 (= E181), R201 (= R198), R207 (= R203), I272 (≠ L260), G273 (= G261), L320 (≠ A308), V353 (= V341)
- binding phosphate ion: R201 (= R198), H202 (vs. gap), R207 (= R203)
Query Sequence
>N515DRAFT_3724 FitnessBrowser__Dyella79:N515DRAFT_3724
MADTYDLIVLGAGSGGLAMAFRAARHGARVALLDPGALGGTCVNVGCVPKKSLWFAAQIA
HSLQLAGPYGFEGVAGRLDWEHFRQRRLAYIDGIKQRYEERLAAAGVQWLREAGRFVAAD
TVATESGAELRAPQIVIATGARPQRPPLPGFELGLVSDDMFALRELPRHVGIVGGGYIAV
EFAGLLRALGSEVTLHVRERMLRTFDRELVDSLEEHMRTQGITLATGARISAARREGDAI
VLDDDSCGERGPYDAVLWALGRVPNTERLDLDAAGVQCDVLGHVVTDPWQNTNVPGIAAL
GDVTGRLALTPVAVAAGRRLADRWFGGRNEARLDYDDVPSVVFSEPPLGAVGLTEAQARA
KFGDSVRVYRSRFTPMQWALAGQHGQTLMKLVCVGDDERVAGVHVLGPGADEMLQGFAVA
VKMGACKRDLDATVAIHPSSGEELVLMS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory