SitesBLAST
Comparing N515DRAFT_3729 N515DRAFT_3729 aminomuconate-semialdehyde/2-hydroxymuconate-6-semialdehyde dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
49% identity, 99% coverage: 4:483/483 of query aligns to 8:487/487 of Q9H2A2
- R109 (= R107) mutation to A: About 65-fold loss of catalytic efficiency.
- N155 (= N152) mutation to A: Complete loss of activity.
- R451 (= R447) mutation to A: Complete loss of activity.
4npiA 1.94 angstroms x-ray crystal structure of NAD- and intermediate- bound alpha-aminomuconate-epsilon-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
45% identity, 99% coverage: 5:482/483 of query aligns to 2:482/483 of 4npiA
- active site: N152 (= N152), K175 (= K175), E251 (= E250), C285 (= C285), E387 (= E387), E464 (= E464)
- binding (2Z,4E)-2-hydroxy-6-oxohexa-2,4-dienoic acid: R103 (= R107), L157 (= L157), W160 (= W160), E251 (= E250), C285 (= C285), Y445 (≠ L445), R447 (= R447), F453 (= F453)
- binding nicotinamide-adenine-dinucleotide: I148 (= I148), S149 (= S149), P150 (= P150), W151 (= W151), K175 (= K175), E178 (= E178), G208 (= G208), G213 (= G212), E214 (≠ Q213), F227 (= F226), G229 (= G228), E230 (≠ S229), T233 (= T232), G253 (= G252), C285 (= C285), K335 (= K335), E387 (= E387), F389 (= F389)
4i2rA 2.15 angstroms x-ray crystal structure of NAD- and alternative substrate-bound 2-aminomuconate 6-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
45% identity, 99% coverage: 5:482/483 of query aligns to 2:482/483 of 4i2rA
- active site: N152 (= N152), K175 (= K175), E251 (= E250), C285 (= C285), E387 (= E387), E464 (= E464)
- binding (2E,4E)-2-hydroxy-6-oxohexa-2,4-dienoic acid: R103 (= R107), L157 (= L157), C285 (= C285), Y445 (≠ L445), R447 (= R447), F453 (= F453)
- binding nicotinamide-adenine-dinucleotide: I148 (= I148), S149 (= S149), W151 (= W151), N152 (= N152), K175 (= K175), E178 (= E178), G208 (= G208), F227 (= F226), T228 (= T227), G229 (= G228), E230 (≠ S229), T233 (= T232), E251 (= E250), L252 (= L251), G253 (= G252), C285 (= C285), E387 (= E387), F389 (= F389)
4i25A 2.00 angstroms x-ray crystal structure of NAD- and substrate-bound 2- aminomuconate 6-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
45% identity, 99% coverage: 5:482/483 of query aligns to 2:482/483 of 4i25A
- active site: N152 (= N152), K175 (= K175), E251 (= E250), C285 (= C285), E387 (= E387), E464 (= E464)
- binding (2E,4E)-2-amino-6-oxohexa-2,4-dienoic acid: R103 (= R107), L157 (= L157), C285 (= C285), Y445 (≠ L445), R447 (= R447), F453 (= F453)
- binding nicotinamide-adenine-dinucleotide: I148 (= I148), S149 (= S149), P150 (= P150), W151 (= W151), N152 (= N152), K175 (= K175), E178 (= E178), G208 (= G208), G213 (= G212), F227 (= F226), T228 (= T227), G229 (= G228), E230 (≠ S229), T233 (= T232), E251 (= E250), L252 (= L251), C285 (= C285), E387 (= E387), F389 (= F389)
5kllA Crystal structure of 2-hydroxymuconate-6-semialdehyde derived tautomeric intermediate in 2-aminomuconate 6-semialdehyde dehydrogenase n169d (see paper)
45% identity, 99% coverage: 5:482/483 of query aligns to 2:482/483 of 5kllA
- active site: D152 (≠ N152), K175 (= K175), E251 (= E250), C285 (= C285), E387 (= E387), E464 (= E464)
- binding (3~{E},5~{E})-6-oxidanyl-2-oxidanylidene-hexa-3,5-dienoic acid: R103 (= R107), D152 (≠ N152), L157 (= L157), W160 (= W160), C285 (= C285), Y445 (≠ L445), R447 (= R447), F453 (= F453)
5kj5B Crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase n169d in complex with NAD+ (see paper)
45% identity, 99% coverage: 5:482/483 of query aligns to 3:483/484 of 5kj5B
- active site: D153 (≠ N152), K176 (= K175), E252 (= E250), C286 (= C285), E388 (= E387), E465 (= E464)
- binding nicotinamide-adenine-dinucleotide: I149 (= I148), S150 (= S149), P151 (= P150), W152 (= W151), D153 (≠ N152), L158 (= L157), K176 (= K175), G209 (= G208), K210 (≠ P209), G214 (= G212), F228 (= F226), T229 (= T227), G230 (= G228), E231 (≠ S229), T234 (= T232), E252 (= E250), L253 (= L251), C286 (= C285), E388 (= E387), F390 (= F389), F454 (= F453)
4ou2A A 2.15 angstroms x-ray crystal structure of e268a 2-aminomuconate 6- semialdehyde dehydrogenase catalytic intermediate from pseudomonas fluorescens (see paper)
45% identity, 99% coverage: 5:482/483 of query aligns to 2:482/483 of 4ou2A
- active site: N152 (= N152), K175 (= K175), A251 (≠ E250), C285 (= C285), E387 (= E387), E464 (= E464)
- binding (2Z,4E)-2,6-dihydroxyhexa-2,4-dienoic acid: R103 (= R107), L157 (= L157), C285 (= C285), Y445 (≠ L445), R447 (= R447), F453 (= F453)
- binding nicotinamide-adenine-dinucleotide: I148 (= I148), S149 (= S149), P150 (= P150), W151 (= W151), N152 (= N152), K175 (= K175), G208 (= G208), G213 (= G212), E214 (≠ Q213), F227 (= F226), T228 (= T227), G229 (= G228), E230 (≠ S229), T233 (= T232), A251 (≠ E250), L252 (= L251), G253 (= G252), C285 (= C285), E387 (= E387), F389 (= F389)
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
46% identity, 98% coverage: 9:481/483 of query aligns to 7:477/489 of 4o6rA
- active site: N150 (= N152), K173 (= K175), E248 (= E250), C282 (= C285), E383 (= E387), E460 (= E464)
- binding adenosine monophosphate: I146 (= I148), V147 (≠ S149), K173 (= K175), G206 (= G208), G210 (= G212), Q211 (= Q213), F224 (= F226), G226 (= G228), S227 (= S229), T230 (= T232), R233 (≠ Q235)
4u3wA X-ray crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase from burkholderia cenocepacia
49% identity, 95% coverage: 26:482/483 of query aligns to 22:483/485 of 4u3wA
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
43% identity, 98% coverage: 10:481/483 of query aligns to 10:480/489 of 4cazA
- active site: N152 (= N152), K175 (= K175), E251 (= E250), C285 (= C285), E386 (= E387), E463 (= E464)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I148), G149 (≠ S149), W151 (= W151), N152 (= N152), K175 (= K175), E178 (= E178), G208 (= G208), G212 (= G212), F226 (= F226), T227 (= T227), G228 (= G228), G229 (≠ S229), T232 (= T232), V236 (≠ I236), E251 (= E250), L252 (= L251), C285 (= C285), E386 (= E387), F388 (= F389)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
43% identity, 98% coverage: 10:481/483 of query aligns to 10:480/489 of 2woxA
- active site: N152 (= N152), K175 (= K175), E251 (= E250), C285 (= C285), E386 (= E387), E463 (= E464)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I148), G149 (≠ S149), W151 (= W151), N152 (= N152), K175 (= K175), S177 (= S177), E178 (= E178), G208 (= G208), G212 (= G212), F226 (= F226), T227 (= T227), G228 (= G228), G229 (≠ S229), T232 (= T232), V236 (≠ I236), E251 (= E250), L252 (= L251), C285 (= C285), E386 (= E387), F388 (= F389)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
43% identity, 98% coverage: 10:481/483 of query aligns to 10:480/489 of 2wmeA
- active site: N152 (= N152), K175 (= K175), E251 (= E250), C285 (= C285), E386 (= E387), E463 (= E464)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ S149), W151 (= W151), K175 (= K175), S177 (= S177), E178 (= E178), G208 (= G208), G212 (= G212), F226 (= F226), G228 (= G228), G229 (≠ S229), T232 (= T232), V236 (≠ I236)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
43% identity, 98% coverage: 10:481/483 of query aligns to 11:481/490 of Q9HTJ1
- GAWN 150:153 (≠ SPWN 149:152) binding
- K162 (= K161) active site, Charge relay system
- KPSE 176:179 (= KPSE 175:178) binding
- G209 (= G208) binding
- GTST 230:233 (≠ STRT 229:232) binding
- E252 (= E250) active site, Proton acceptor
- C286 (= C285) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E387) binding
- E464 (= E464) active site, Charge relay system
4go4A Crystal structure of pnpe in complex with nicotinamide adenine dinucleotide
44% identity, 98% coverage: 10:481/483 of query aligns to 7:475/487 of 4go4A
- active site: N149 (= N152), K172 (= K175), E247 (= E250), C281 (= C285), E381 (= E387), E458 (= E464)
- binding nicotinamide-adenine-dinucleotide: I145 (= I148), V146 (≠ S149), W148 (= W151), N149 (= N152), F154 (≠ L157), K172 (= K175), G205 (= G208), G209 (= G212), Q210 (= Q213), F223 (= F226), T224 (= T227), G225 (= G228), S226 (= S229), T229 (= T232), E247 (= E250), G249 (= G252), C281 (= C285), E381 (= E387), F383 (= F389)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
42% identity, 98% coverage: 10:482/483 of query aligns to 9:480/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
42% identity, 98% coverage: 10:482/483 of query aligns to 9:480/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
42% identity, 98% coverage: 10:482/483 of query aligns to 9:480/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
42% identity, 98% coverage: 10:482/483 of query aligns to 9:480/488 of 8vqwC
- binding coenzyme a: I147 (= I148), W150 (= W151), K174 (= K175), S176 (= S177), E177 (= E178), G207 (= G208), G211 (= G212), F225 (= F226), G227 (= G228), G228 (≠ S229), S231 (≠ T232), H331 (= H332), F387 (= F389)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
42% identity, 98% coverage: 10:482/483 of query aligns to 9:480/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
42% identity, 98% coverage: 10:482/483 of query aligns to 9:480/488 of 8uzoA
Query Sequence
>N515DRAFT_3729 N515DRAFT_3729 aminomuconate-semialdehyde/2-hydroxymuconate-6-semialdehyde dehydrogenase
MPSLRLANLIDGRLQAPRQERWLEVFEPATGEVFAHCPESSFADVDAAVAAAVAAAPGWA
ATPSEQRARLLQRLADLIEARLDEFAALESRDSGKPLSLARSLDIPRAVSNLRYFAAAIV
PWSSESHAMELGAINYTLRQPLGVVACISPWNLPLYLFTWKIAPALAAGNAVVAKPSEIT
PCTAALLGELSIEAGFPPGVLNIVQGRGPEVGQALVEHRDVKAVSFTGSTRTGAQIAAAA
APRFKKLSLELGGKNPAIVFADADLSDANLDTIVRSGFANQGEICLCGSRLLVQRSIYDA
FRERYLAKVRALRVGDPREAATDLGALVSREHFDKVTGCIAQARAEGGRVLCGGDALALP
GPLAGGWYVAPTVIEGLGPETATNQQEIFGPVVTLIPFDDEAQALAIANGTGYGLAASLW
TTDLSRAHRFGAQLDFGIVWINCWLLRDLRTPFGGAKQSGVGREGGVEALRFFTEPKNIC
IRY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory