Comparing N515DRAFT_3767 FitnessBrowser__Dyella79:N515DRAFT_3767 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
70% identity, 99% coverage: 1:362/366 of query aligns to 1:363/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
69% identity, 99% coverage: 1:362/366 of query aligns to 2:358/360 of 2f7vA
7rsfA Acetylornithine deacetylase from escherichia coli
25% identity, 80% coverage: 71:361/366 of query aligns to 77:374/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
24% identity, 90% coverage: 30:359/366 of query aligns to 28:373/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
24% identity, 66% coverage: 42:282/366 of query aligns to 37:293/377 of 7t1qA
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
25% identity, 84% coverage: 9:317/366 of query aligns to 19:322/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
25% identity, 84% coverage: 9:317/366 of query aligns to 44:347/415 of P06621
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
25% identity, 70% coverage: 61:317/366 of query aligns to 12:257/392 of 7m6uB
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 56% coverage: 42:247/366 of query aligns to 37:258/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 56% coverage: 42:247/366 of query aligns to 37:258/376 of 4o23A
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
23% identity, 68% coverage: 24:272/366 of query aligns to 24:287/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
23% identity, 68% coverage: 24:272/366 of query aligns to 20:283/377 of P44514
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 61% coverage: 42:266/366 of query aligns to 57:295/408 of Q03154
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
33% identity, 30% coverage: 24:131/366 of query aligns to 22:138/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
25% identity, 49% coverage: 67:246/366 of query aligns to 100:294/426 of 3pfoA
Sites not aligning to the query:
>N515DRAFT_3767 FitnessBrowser__Dyella79:N515DRAFT_3767
MSQLLDDTLRHLRALVSHDTRNPPREIGTGGIFDYLREQLAGFEVTVTDFGAGAVNLYAV
RGKPKYLFNVHLDTVPDSPHWSADPHVLRVEGDRAIGLGACDIKGAAAALVAVANATQGD
MALLLSTDEEANDARCIAGFLKDHPVYEAVIVAEPTKGEAVLAHRGIHSVQMRFSGKAGH
ASGEQKPSDSAVHQAVRWGVAALDYVESQAHERFGGLTGLRFNIGKVEGGIKANVIAPTA
DVRFGFRPLPSMDADRMLETFRTLVEPQPVEFGETFRGDSLPAGDTATAETRRLAARDLA
DELGIPVGNAVNFWTEAALFSAAGYISFVYGPGDIAQAHAADEWVALEQLDHYAQTIYRI
VDRGSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory