Comparing N515DRAFT_3768 FitnessBrowser__Dyella79:N515DRAFT_3768 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4kztA Structure mmnags bound with l-arginine (see paper)
53% identity, 98% coverage: 8:436/438 of query aligns to 1:429/431 of 4kztA
3s6hA Crystal structure of native mmnags/k (see paper)
53% identity, 98% coverage: 8:436/438 of query aligns to 5:433/436 of 3s6hA
4ab7H Crystal structure of a tetrameric acetylglutamate kinase from saccharomyces cerevisiae complexed with its substrate n- acetylglutamate (see paper)
42% identity, 93% coverage: 22:428/438 of query aligns to 2:416/422 of 4ab7H
3zzhC Crystal structure of the amino acid kinase domain from saccharomyces cerevisiae acetylglutamate kinase in complex with its feed- back inhibitor l-arginine (see paper)
50% identity, 65% coverage: 7:289/438 of query aligns to 5:288/288 of 3zzhC
Q8N159 N-acetylglutamate synthase, mitochondrial; Amino-acid acetyltransferase; EC 2.3.1.1 from Homo sapiens (Human) (see 4 papers)
33% identity, 96% coverage: 8:428/438 of query aligns to 103:517/534 of Q8N159
Sites not aligning to the query:
4nexA Structure of the n-acetyltransferase domain of x. Fastidiosa nags/k (see paper)
61% identity, 36% coverage: 282:438/438 of query aligns to 1:157/157 of 4nexA
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
34% identity, 63% coverage: 12:287/438 of query aligns to 7:281/289 of 2v5hB
4k30A Structure of the n-acetyltransferase domain of human n-acetylglutamate synthase (see paper)
40% identity, 33% coverage: 293:436/438 of query aligns to 3:151/153 of 4k30A
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
29% identity, 60% coverage: 27:287/438 of query aligns to 20:286/292 of 2bufA
Q9HTN2 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
30% identity, 60% coverage: 27:287/438 of query aligns to 21:295/301 of Q9HTN2
Sites not aligning to the query:
2bufC Arginine feed-back inhibitable acetylglutamate kinase (see paper)
30% identity, 60% coverage: 27:287/438 of query aligns to 20:294/298 of 2bufC
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
30% identity, 60% coverage: 27:289/438 of query aligns to 15:279/282 of 2btyA
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 60% coverage: 27:289/438 of query aligns to 15:279/282 of Q9X2A4
2ap9A Crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551
32% identity, 62% coverage: 21:291/438 of query aligns to 10:292/299 of 2ap9A
Sites not aligning to the query:
7nlyA Crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole.
31% identity, 62% coverage: 21:290/438 of query aligns to 12:293/293 of 7nlyA
7nlxA Crystal structure of mycobacterium tuberculosis argb in complex with 7-(trifluoromethyl)quinolin-4-ol.
31% identity, 62% coverage: 21:290/438 of query aligns to 9:290/290 of 7nlxA
7nlnA Crystal structure of mycobacterium tuberculosis argb in complex with n-acetyl-glutamate
31% identity, 62% coverage: 21:290/438 of query aligns to 9:290/290 of 7nlnA
7nlpA Crystal structure of mycobacterium tuberculosis argb in complex with l-canavanine
31% identity, 62% coverage: 21:290/438 of query aligns to 11:292/292 of 7nlpA
7nloA Crystal structure of mycobacterium tuberculosis argb in complex with l-arginine
31% identity, 62% coverage: 21:290/438 of query aligns to 8:289/289 of 7nloA
7nnbA Crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
31% identity, 62% coverage: 21:290/438 of query aligns to 10:291/291 of 7nnbA
>N515DRAFT_3768 FitnessBrowser__Dyella79:N515DRAFT_3768
MEAHKHTRKTIVRLLSSMGSAKEIQQYLKRFSQLDAKRFAVVKVGGAVLRDDLPALTSSL
TFLQQVGLTPIVLHGAGPQLDEELSAAGIQKQTVNGLRVTSPKALAIVRKVFQEQNLRLV
EALQGMDTRATSVPSGVFTSEYLDRDVYGLVGKVSSINLAPIEASLRAGSIPVIASLGET
AEGQILNINADFAANELVRVLQPYKIVFLTGTGGLLDDKGRIIDSINLSTEYEHLMAQPW
INGGMRVKIEQIADLLSSLPLTSSVSITQPSELAKELFTHKGSGTLVRRGEKVLRYESWE
GIDLARMRELIESSFGRKVVADYFERTRPYRIYVSENYRAAMILTQEEGLAYLDKFAVLD
DAQGEGLGRAVWQVMREENPQLFWRSRHGNQVNIFYYAESDGCFKQERWKVFWYGLKNFG
EIERCVAHCAVRPATLMD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory