Comparing N515DRAFT_3772 FitnessBrowser__Dyella79:N515DRAFT_3772 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
44% identity, 94% coverage: 17:374/380 of query aligns to 6:364/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 94% coverage: 17:374/380 of query aligns to 8:366/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 94% coverage: 17:374/380 of query aligns to 6:324/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 94% coverage: 17:373/380 of query aligns to 6:321/323 of 2j5vA
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
24% identity, 28% coverage: 156:263/380 of query aligns to 121:225/226 of 2bmuB
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
24% identity, 28% coverage: 156:263/380 of query aligns to 120:224/225 of Q8U122
Sites not aligning to the query:
>N515DRAFT_3772 FitnessBrowser__Dyella79:N515DRAFT_3772
MAEHLPAQPLPNWRRAVLKVGSNLLAADGGGLTPRHARALAAFIGDSHAQGRQVVLVSSG
AVAAGRALLRERALPGDDLAARQALAALGQAPMIALWQSLSPRPVAQVLLTHDDLRHRRR
YLNARATLRELLLLDVLPVVNENDTVAVDELKLGDNDNLAAIVAALVDADLLLIASDIDA
LYDADPRRVPSAVPVPHVSTLTAEVMAMAGGSGSAVGTGGMHTKLEAAVKAGAAGVPTVL
FDGRNTETVAALAAGQLHGTLFDAPRSRMQARKYWLRHAPAAPGSILVDDGAARALAGGR
ASLLPGGIVGADGEFHRGDMVEIVDVTRRPVARGLSQYGAAEVRRLAGRHSSAIDAVLGY
SYGAEIVHRDDLVVLAEVHS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory