SitesBLAST
Comparing N515DRAFT_3772 FitnessBrowser__Dyella79:N515DRAFT_3772 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
44% identity, 94% coverage: 17:374/380 of query aligns to 6:364/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 94% coverage: 17:374/380 of query aligns to 8:366/367 of P0A7B5
- S50 (= S59) binding
- D137 (= D144) binding
- N149 (= N156) binding
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 94% coverage: 17:374/380 of query aligns to 6:324/325 of 2j5vB
- binding pyroglutamic acid: T11 (≠ S22), G49 (= G60), A50 (= A61), I51 (≠ V62), A52 (= A63), D135 (= D144)
- binding gamma-glutamyl phosphate: K8 (= K19), S48 (= S59), D135 (= D144), G145 (= G154), D146 (= D155), N147 (= N156)
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 94% coverage: 17:373/380 of query aligns to 6:321/323 of 2j5vA
- binding magnesium ion: K8 (= K19), G10 (= G21), L166 (≠ A175)
- binding pyroglutamic acid: T11 (≠ S22), S48 (= S59), G49 (= G60), A50 (= A61), I51 (≠ V62)
- binding gamma-glutamyl phosphate: K8 (= K19), G10 (= G21), S48 (= S59), D135 (= D144), D146 (= D155), N147 (= N156)
8j0gB Gk monomer complexes with glutamate and atp
31% identity, 66% coverage: 14:262/380 of query aligns to 8:267/274 of 8j0gB
- binding adenosine-5'-triphosphate: K13 (= K19), G15 (= G21), T16 (≠ S22), A17 (≠ N23), V185 (≠ I178), G191 (vs. gap), P193 (vs. gap), F215 (≠ A203), R223 (≠ T218), G225 (= G220), M226 (= M221), K229 (= K224)
- binding gamma-l-glutamic acid: A55 (= A61), N147 (= N141), D150 (= D144), N163 (= N156), R223 (≠ T218)
- binding magnesium ion: R223 (≠ T218), G224 (= G219), G225 (= G220)
- binding : Y65 (≠ E71), L68 (= L74), V69 (≠ P75), F73 (≠ L79)
8j0eB Gk monomer complexes with catalytic intermediate
30% identity, 66% coverage: 14:262/380 of query aligns to 11:262/269 of 8j0eB
- binding magnesium ion: D163 (= D157), G219 (= G219)
- binding (2~{R})-5-[[[[(2~{R},3~{S},4~{S},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-2-azanyl-5-oxidanylidene-pentanoic acid: K16 (= K19), G18 (= G21), T19 (≠ S22), A20 (≠ N23), S56 (= S59), G57 (= G60), V59 (= V62), D153 (= D144), N162 (= N156), V184 (≠ I178), P192 (vs. gap), K217 (≠ G217), R218 (≠ T218), G219 (= G219), G220 (= G220), M221 (= M221)
- binding : Y68 (≠ E71), L71 (= L74), V72 (≠ P75), V72 (≠ P75), S74 (≠ D77), F76 (≠ L79), F76 (≠ L79), Q80 (= Q83)
8j0fA Gk tetramer with adjacent hooks at reaction state
32% identity, 66% coverage: 14:262/380 of query aligns to 12:261/270 of 8j0fA
- binding adenosine-5'-diphosphate: A21 (≠ N23), D183 (= D177), V184 (≠ I178), Y188 (= Y182), G190 (≠ A184), F214 (≠ S212), G219 (= G220), M220 (= M221)
- binding magnesium ion: R217 (≠ T218), G218 (= G219), G219 (= G220)
- binding gamma-glutamyl phosphate: K17 (= K19), T20 (≠ S22), S57 (= S59), D154 (= D144), N162 (= N156), R217 (≠ T218)
- binding : L72 (= L74), V73 (≠ P75), N74 (≠ G76), S75 (≠ D77), S76 (≠ D78), F77 (≠ L79), F77 (≠ L79), A78 (= A80), L80 (≠ R82)
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
24% identity, 28% coverage: 156:263/380 of query aligns to 121:225/226 of 2bmuB
- binding phosphoaminophosphonic acid-adenylate ester: T141 (≠ S176), N142 (≠ D177), V146 (≠ L181), Y147 (= Y182), A149 (= A184), D150 (= D185), P151 (= P186), S182 (≠ G219), S183 (≠ G220), V184 (≠ M221)
- binding magnesium ion: D122 (= D157), D122 (= D157), S183 (≠ G220), V184 (≠ M221)
- binding uridine-5'-monophosphate: T121 (≠ N156), A179 (≠ V216)
Sites not aligning to the query:
- binding phosphoaminophosphonic acid-adenylate ester: 9, 10, 44, 45, 46
- binding magnesium ion: 7
- binding uridine-5'-monophosphate: 44, 45, 67, 70, 71, 114, 115, 116, 119, 120
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
24% identity, 28% coverage: 156:263/380 of query aligns to 120:224/225 of Q8U122
- T120 (≠ N156) binding
- D121 (= D157) binding ; binding
- G179 (= G217) binding
- S182 (≠ G220) binding
Sites not aligning to the query:
- 6 binding
- 44 binding
- 66 binding
- 114:120 binding
Query Sequence
>N515DRAFT_3772 FitnessBrowser__Dyella79:N515DRAFT_3772
MAEHLPAQPLPNWRRAVLKVGSNLLAADGGGLTPRHARALAAFIGDSHAQGRQVVLVSSG
AVAAGRALLRERALPGDDLAARQALAALGQAPMIALWQSLSPRPVAQVLLTHDDLRHRRR
YLNARATLRELLLLDVLPVVNENDTVAVDELKLGDNDNLAAIVAALVDADLLLIASDIDA
LYDADPRRVPSAVPVPHVSTLTAEVMAMAGGSGSAVGTGGMHTKLEAAVKAGAAGVPTVL
FDGRNTETVAALAAGQLHGTLFDAPRSRMQARKYWLRHAPAAPGSILVDDGAARALAGGR
ASLLPGGIVGADGEFHRGDMVEIVDVTRRPVARGLSQYGAAEVRRLAGRHSSAIDAVLGY
SYGAEIVHRDDLVVLAEVHS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory