SitesBLAST
Comparing N515DRAFT_3776 FitnessBrowser__Dyella79:N515DRAFT_3776 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
44% identity, 95% coverage: 16:422/428 of query aligns to 29:443/447 of 2hzpA
- active site: F160 (= F135), D245 (= D220), Y270 (= Y245), K271 (= K246), R421 (= R400)
- binding pyridoxal-5'-phosphate: L132 (= L107), T133 (≠ G108), F160 (= F135), D163 (= D138), D245 (= D220), A247 (= A222), H248 (= H223), Y270 (= Y245), K271 (= K246)
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
44% identity, 95% coverage: 16:422/428 of query aligns to 34:456/464 of P70712
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
44% identity, 95% coverage: 16:422/428 of query aligns to 29:442/446 of 3e9kA
- active site: F160 (= F135), D245 (= D220), Y270 (= Y245), K271 (= K246), R420 (= R400)
- binding 3-Hydroxyhippuric acid: S70 (= S45), F160 (= F135), H248 (= H223), K271 (= K246), R420 (= R400)
- binding pyridoxal-5'-phosphate: L132 (= L107), T133 (≠ G108), F160 (= F135), D163 (= D138), D245 (= D220), A247 (= A222), H248 (= H223), Y270 (= Y245), K271 (= K246)
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
44% identity, 95% coverage: 16:422/428 of query aligns to 34:456/465 of Q16719
- T138 (≠ G108) binding
- T198 (= T168) to A: in HYXKY; reduced 3-hydroxykynureninase activity; dbSNP:rs606231307
- D250 (= D220) binding
- H253 (= H223) binding
- Y275 (= Y245) binding
- W305 (= W276) binding
- N333 (= N304) binding
- K412 (≠ R378) to E: in dbSNP:rs9013
Sites not aligning to the query:
- 156:465 natural variant: Missing (in VCRL2; strongly reduced 3-hydroxykynureninase activity)
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
35% identity, 93% coverage: 14:412/428 of query aligns to 8:386/404 of 1qz9A
- active site: F128 (= F135), D200 (= D220), Y225 (= Y245), K226 (= K246), R374 (= R400)
- binding pyridoxal-5'-phosphate: T95 (= T106), T96 (≠ L107), S97 (≠ G108), F128 (= F135), D131 (= D138), T171 (≠ P191), D200 (= D220), A202 (= A222), H203 (= H223), C223 (= C243), Y225 (= Y245), K226 (= K246)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
35% identity, 93% coverage: 14:412/428 of query aligns to 9:387/416 of P83788
- T97 (≠ L107) binding
- S98 (≠ G108) binding
- D132 (= D138) mutation to A: Reduces binding to pyridoxal phosphate and strongly reduces catalytic activity.; mutation to E: Enhances binding to pyridoxal phosphate.
- T172 (≠ P191) binding
- D201 (= D220) binding ; mutation to E: Enhances binding to pyridoxal phosphate.
- H204 (= H223) binding
6rv0A Human alanine:glyoxylate aminotransferase major allele (agt-ma); with pmp in the active site (see paper)
25% identity, 42% coverage: 164:342/428 of query aligns to 124:300/384 of 6rv0A
Sites not aligning to the query:
1j04A Structural mechanism of enzyme mistargeting in hereditary kidney stone disease in vitro (see paper)
25% identity, 42% coverage: 164:342/428 of query aligns to 126:302/387 of 1j04A
Sites not aligning to the query:
5hhyA Structure of human alanine:glyoxylate aminotransferase major allele (agt-ma) showing x-ray induced reduction of plp internal aldimine to 4'-deoxy-piridoxine-phosphate (plr) (see paper)
25% identity, 42% coverage: 164:342/428 of query aligns to 124:300/385 of 5hhyA
Sites not aligning to the query:
1h0cA The crystal structure of human alanine:glyoxylate aminotransferase (see paper)
25% identity, 42% coverage: 164:342/428 of query aligns to 124:300/385 of 1h0cA
Sites not aligning to the query:
P21549 Alanine--glyoxylate aminotransferase; AGT; Serine--pyruvate aminotransferase; SPT; EC 2.6.1.44; EC 2.6.1.51 from Homo sapiens (Human) (see 24 papers)
25% identity, 42% coverage: 164:342/428 of query aligns to 129:305/392 of P21549
- L150 (= L187) to P: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177222
- F152 (≠ L189) to I: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in protein destabilization; decreased alanine--glyoxylate aminotransferase activity; no loss of dimerization; mitochondrial mistargeting; dbSNP:rs121908524
- G156 (≠ V193) to R: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; dbSNP:rs121908530
- S158 (≠ Y195) to L: in HP1; loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177225
- G161 (= G198) to C: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; reduced peroxisomal localization; dbSNP:rs180177227; to R: in HP1; loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; loss of dimerization; dbSNP:rs180177227; to S: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; reduced peroxisomal localization; dbSNP:rs180177227
- L166 (= L203) to P: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177230
- G170 (≠ T207) to R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in mitochondrial mistargeting; slight decrease in alanine--glyoxylate aminotransferase activity; loss of dimerization; partial loss of protein stability but protein stability increases in the presence of pyridoxal phosphate; causes protein aggregation; dbSNP:rs121908529
- C173 (≠ A210) to Y: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; causes protein aggregation; dbSNP:rs180177231
- D183 (= D220) to N: in HP1; loss of alanine--glyoxylate aminotransferase activity; no loss of dimerization; no effect on protein stability; dbSNP:rs180177236
- S187 (≠ A224) to F: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization but improved dimerization in the presence of pyridoxal phosphate; decreased protein stability; dbSNP:rs180177238
- I202 (≠ F239) to N: in HP1; uncertain significance; dbSNP:rs536352238
- S205 (≠ W242) to P: in HP1; loss of alanine--glyoxylate aminotransferase activity; decreased protein stability; dbSNP:rs121908520
- K209 (= K246) mutation to R: Affects pyridoxal phosphate binding; loss of alanine--glyoxylate aminotransferase activity.
- S218 (≠ V255) to L: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; no effect on protein stability; dbSNP:rs180177253
- R233 (vs. gap) to C: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs121908526; to H: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs121908527
- I244 (≠ L270) to T: in HP1; prevalent mutation in the Canary islands; when associated with L-11 and M-340 on the minor AGXT allele; results in protein misfolding; decreased alanine--glyoxylate aminotransferase activity; no loss of dimerization; partial mitochondrial mistargeting; dbSNP:rs121908525
- C253 (≠ H279) to R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177264
- I279 (≠ F320) to T: in dbSNP:rs140992177
- A280 (≠ H321) to V: in dbSNP:rs73106685
Sites not aligning to the query:
- 9 T → N: no loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs115014558
- 11 P → L: reduction of specific alanine--glyoxylate aminotransferase activity in vitro; causes mitochondrial mistargeting when associated with R-170; dbSNP:rs34116584
- 36 R → C: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177157
- 41 G → E: in HP1; loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177168; G → R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of protein stability; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; partial mitochondrial mistargeting; intraperoxisomal protein aggregation seen; dbSNP:rs121908523; G → V: in HP1; reduced alanine--glyoxylate aminotransferase activity; no loss of dimerization; no effect on protein stability; dbSNP:rs180177168
- 47 G → R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in protein misfolding; decreased alanine--glyoxylate aminotransferase activity; reduced expression levels; reduced pyridoxal phosphate binding; reduced dimerization; reduced thermostability; increased propensity to aggregation; increased susceptibility to proteolytic degradation within the N-terminal region; mitochondrial mistargeting; exposure to pyridoxine can rescue the functionality by partially preventing aggregation and degradation and by redirecting all the protein to the peroxisome; dbSNP:rs180177173
- 82 G → E: in HP1; abolishes alanine--glyoxylate aminotransferase activity by interfering with pyridoxal phosphate binding; dbSNP:rs121908522
- 108 W → R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; dbSNP:rs180177197
- 112 A → D: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; causes protein aggregation; dbSNP:rs796052061
- 326 V → I: in dbSNP:rs115057148
- 340 I → M: associated with hyperoxaluria; dbSNP:rs4426527
Query Sequence
>N515DRAFT_3776 FitnessBrowser__Dyella79:N515DRAFT_3776
MSNAYQATLEWARAQDAADPLRAFRDEFLIPPHDGRASHYFCGNSLGLQPRAVREALTAE
LDDWGALAVEGHFKGRQPWLDYHEYVRDDLAELVGALPSEVVAMNTLGVNLHLMMVSFYR
PTPDRHAILIEAGAFPTDRYAVESQIRFHGFSPTLSLIELEPDEPNGTLSMGAIERALAE
HGERIALVLLPGVQYRTGQAFDLKAITGLAHRQGCTVGFDLAHAVGNLPLRLHDSGADFA
VWCSYKYLNSGPGAVAGAFVHDRHARTEHLPRFAGWWGHDKQSRFRMGPEFVPTPGADGW
QISNPPILSLAPLRVSLQIFHRAGMARLREKSLRLTGYLEWLVQTQLADVLESVTPRETE
RRGSQLSLRVLGGRERGRALFEYLMEHGVVGDWREPDVIRISPAPLYNRFEDCVGFAEAV
RAWAHRPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory