Comparing N515DRAFT_3784 FitnessBrowser__Dyella79:N515DRAFT_3784 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
42% identity, 92% coverage: 2:173/186 of query aligns to 4:175/179 of 5wphA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
42% identity, 92% coverage: 2:173/186 of query aligns to 4:175/176 of 6m7gA
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
38% identity, 86% coverage: 2:161/186 of query aligns to 4:163/175 of 5t7eD
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
38% identity, 86% coverage: 2:161/186 of query aligns to 3:162/173 of 5t7dA
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
37% identity, 90% coverage: 2:168/186 of query aligns to 5:174/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
40% identity, 87% coverage: 1:162/186 of query aligns to 5:169/181 of 5dwnA
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
34% identity, 87% coverage: 1:161/186 of query aligns to 4:165/165 of 4mbuA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
31% identity, 90% coverage: 2:169/186 of query aligns to 5:173/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 90% coverage: 2:169/186 of query aligns to 3:171/171 of Q8ZPD3
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
32% identity, 66% coverage: 45:166/186 of query aligns to 55:177/180 of 2jlmF
Sites not aligning to the query:
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
30% identity, 86% coverage: 1:160/186 of query aligns to 5:165/165 of 4jwpA
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
30% identity, 89% coverage: 2:167/186 of query aligns to 5:172/172 of A6VCX3
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
30% identity, 89% coverage: 2:167/186 of query aligns to 3:170/170 of 2j8rA
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
30% identity, 89% coverage: 2:167/186 of query aligns to 4:171/171 of 2j8mA
>N515DRAFT_3784 FitnessBrowser__Dyella79:N515DRAFT_3784
MIRIAVPADAAAIHAIYTPHVLQGMATFETELPGEAAMRERIAGRLPHYPWIVWEEHGRL
LAYAYASRFRERAAYDWIAETSIYVHEDAQRRGIARRLYGVLLDGMRLQGINQAVGVITM
PGEASVAMHETMGFAPAGIWRKAGYKLGQWWDVGVWQKELQAPAVPPTAVIPFAQLRDRA
EWQALL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory