Comparing N515DRAFT_3908 FitnessBrowser__Dyella79:N515DRAFT_3908 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
42% identity, 93% coverage: 3:263/282 of query aligns to 8:265/269 of B1VB61
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 78% coverage: 42:262/282 of query aligns to 40:264/264 of P37451
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
38% identity, 96% coverage: 6:276/282 of query aligns to 9:280/281 of P0AER0
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
41% identity, 87% coverage: 6:251/282 of query aligns to 4:250/254 of 1fx8A
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
33% identity, 97% coverage: 7:279/282 of query aligns to 23:295/301 of Q96PS8
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
34% identity, 98% coverage: 2:278/282 of query aligns to 31:303/342 of O14520
Sites not aligning to the query:
6f7hC Crystal structure of human aqp10 (see paper)
34% identity, 87% coverage: 7:251/282 of query aligns to 8:249/253 of 6f7hC
8c9hA Aqp7_inhibitor
36% identity, 89% coverage: 2:251/282 of query aligns to 6:251/253 of 8c9hA
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
36% identity, 89% coverage: 1:251/282 of query aligns to 3:245/249 of 6n1gA
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
40% identity, 73% coverage: 49:254/282 of query aligns to 100:299/306 of I1CR68
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
28% identity, 89% coverage: 5:256/282 of query aligns to 3:240/242 of 3c02A
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
31% identity, 89% coverage: 1:252/282 of query aligns to 1:245/245 of 2evuA
P47863 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Rattus norvegicus (Rat) (see 4 papers)
32% identity, 85% coverage: 33:273/282 of query aligns to 64:276/323 of P47863
Sites not aligning to the query:
P55088 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Mus musculus (Mouse) (see 2 papers)
30% identity, 93% coverage: 12:273/282 of query aligns to 44:276/323 of P55088
Sites not aligning to the query:
P06624 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Bos taurus (Bovine) (see 4 papers)
29% identity, 94% coverage: 16:280/282 of query aligns to 23:255/263 of P06624
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
27% identity, 89% coverage: 7:256/282 of query aligns to 39:253/271 of P08995
Sites not aligning to the query:
P09011 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 95% coverage: 12:280/282 of query aligns to 17:253/261 of P09011
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
27% identity, 96% coverage: 5:275/282 of query aligns to 48:284/298 of Q6Z2T3
P30301 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Homo sapiens (Human) (see 10 papers)
29% identity, 95% coverage: 12:280/282 of query aligns to 19:255/263 of P30301
Sites not aligning to the query:
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 92% coverage: 7:266/282 of query aligns to 81:304/305 of Q9SAI4
>N515DRAFT_3908 FitnessBrowser__Dyella79:N515DRAFT_3908
MRQAIGELISEALAMFIIIGLGDSVACMYVLYDPSPYQNAYWGVCIAWGLAVTIAIYATA
SISGTHANPAVTLALAIFRGFPWKKVLPYTVAQVIGAFLGAAIVYVLFGPVIDHYNQAHG
LTREAGGAAGVFFTHPGLAVTPMHALLDQVILTAFLLFGIFAITERFNEMAPGANSGALM
IGLLVATIGACMGYLEAWAINPARDFGPRLFAFFAGWGQSALPSPDNYWWIPIVGPLIGG
VVGAGAYQLLVHPFLPARLRELEAARMAQAKGEPAAPSNPAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory