Comparing N515DRAFT_3950 N515DRAFT_3950 lipopolysaccharide export system ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
59% identity, 100% coverage: 1:239/239 of query aligns to 2:240/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
61% identity, 100% coverage: 2:239/239 of query aligns to 4:241/241 of 6mbnA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
61% identity, 99% coverage: 2:237/239 of query aligns to 3:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
61% identity, 99% coverage: 2:237/239 of query aligns to 3:238/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
62% identity, 97% coverage: 2:234/239 of query aligns to 3:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
62% identity, 97% coverage: 2:233/239 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
62% identity, 97% coverage: 2:233/239 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
61% identity, 97% coverage: 2:232/239 of query aligns to 3:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 98% coverage: 1:234/239 of query aligns to 6:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 98% coverage: 1:235/239 of query aligns to 4:254/254 of 1g6hA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
35% identity, 88% coverage: 14:224/239 of query aligns to 17:230/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
35% identity, 88% coverage: 14:224/239 of query aligns to 17:230/263 of 7d08B
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
35% identity, 88% coverage: 14:224/239 of query aligns to 15:228/253 of 6z5uK
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 98% coverage: 1:234/239 of query aligns to 4:253/253 of 1g9xB
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 93% coverage: 1:223/239 of query aligns to 3:226/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 93% coverage: 1:223/239 of query aligns to 3:226/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 93% coverage: 1:223/239 of query aligns to 3:226/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 93% coverage: 1:223/239 of query aligns to 3:226/242 of 2oljA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 93% coverage: 6:227/239 of query aligns to 22:240/378 of P69874
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 93% coverage: 1:222/239 of query aligns to 4:223/285 of 4yerA
>N515DRAFT_3950 N515DRAFT_3950 lipopolysaccharide export system ATP-binding protein
MLSAEGLQKRFRTRQVVRDFAFSIREGEVVGLLGPNGAGKTTCFYMVVGLIEADAGTIKL
DKYDITGLPMHARAKLGIGYLPQEPSVFRRLTVADNIMAVLELRENLSAKQRAGELESLL
DELKIAHIADQRGISLSGGERRRVEIARALAAEPRYMLLDEPFAGVDPISVGEIQRIVRH
LKERGIGVLITDHNVRETLGICDRAYILNDGEVLSRGTPAHILADEKVREVYLGREFRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory