Comparing N515DRAFT_3995 FitnessBrowser__Dyella79:N515DRAFT_3995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D5EY15 Xylan 1,4-beta-xylosidase; 1,4-beta-D-xylan xylohydrolase; Alpha-L-arabinofuranosidase; Arabinosidase; Beta-D-xylosidase; Exo-1,4-beta-xylosidase; EC 3.2.1.37; EC 3.2.1.55 from Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) (see paper)
38% identity, 95% coverage: 19:852/874 of query aligns to 10:846/861 of D5EY15
7vc7A The structure of beta-xylosidase from phanerochaete chrysosporium(pcbxl3) (see paper)
41% identity, 47% coverage: 31:440/874 of query aligns to 15:436/743 of 7vc7A
Sites not aligning to the query:
5ae6B The structure of hypocrea jecorina beta-xylosidase xyl3a (bxl1) in complex with 4-thioxylobiose
39% identity, 49% coverage: 17:441/874 of query aligns to 22:459/767 of 5ae6B
Sites not aligning to the query:
5a7mA The structure of hypocrea jecorina beta-xylosidase xyl3a (bxl1)
39% identity, 49% coverage: 17:441/874 of query aligns to 22:459/761 of 5a7mA
Sites not aligning to the query:
7xtjB Crystal structure of e88a mutant of gh3 beta-xylosidase from aspergillus niger (anbx) (see paper)
38% identity, 47% coverage: 29:441/874 of query aligns to 14:437/743 of 7xtjB
6q7jA Gh3 exo-beta-xylosidase (xlnd) in complex with xylobiose aziridine activity based probe (see paper)
39% identity, 46% coverage: 41:441/874 of query aligns to 52:458/770 of 6q7jA
Sites not aligning to the query:
6q7iA Gh3 exo-beta-xylosidase (xlnd) (see paper)
39% identity, 46% coverage: 41:441/874 of query aligns to 52:458/770 of 6q7iA
3ac0A Crystal structure of beta-glucosidase from kluyveromyces marxianus in complex with glucose (see paper)
28% identity, 95% coverage: 44:870/874 of query aligns to 7:836/841 of 3ac0A
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
35% identity, 41% coverage: 53:409/874 of query aligns to 78:415/763 of 7zdyW
Sites not aligning to the query:
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
35% identity, 41% coverage: 53:409/874 of query aligns to 78:415/753 of 7zgzX
Sites not aligning to the query:
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
35% identity, 41% coverage: 53:409/874 of query aligns to 78:415/765 of 7zb3A
Sites not aligning to the query:
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
35% identity, 41% coverage: 53:409/874 of query aligns to 78:415/772 of 8c7fA
Sites not aligning to the query:
5z87A Structural of a novel b-glucosidase emgh1 at 2.3 angstrom from erythrobacter marinus
36% identity, 45% coverage: 55:443/874 of query aligns to 79:459/756 of 5z87A
Sites not aligning to the query:
5z9sA Functional and structural characterization of a beta-glucosidase involved in saponin metabolism from intestinal bacteria (see paper)
33% identity, 42% coverage: 38:400/874 of query aligns to 1:390/765 of 5z9sA
Sites not aligning to the query:
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
34% identity, 44% coverage: 53:440/874 of query aligns to 51:432/733 of 5tf0A
Sites not aligning to the query:
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
33% identity, 48% coverage: 23:445/874 of query aligns to 31:450/749 of 5xxmA
Sites not aligning to the query:
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
34% identity, 45% coverage: 53:445/874 of query aligns to 51:439/744 of 5xxnA
Sites not aligning to the query:
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
33% identity, 45% coverage: 54:446/874 of query aligns to 60:439/742 of 3u48B
Sites not aligning to the query:
7eapA Crystal structure of ipea-xxxg complex (see paper)
33% identity, 42% coverage: 68:438/874 of query aligns to 92:453/755 of 7eapA
Sites not aligning to the query:
5yqsA Isoprimeverose-producing enzyme from aspergillus oryzae in complex with isoprimeverose (see paper)
33% identity, 42% coverage: 68:438/874 of query aligns to 91:452/754 of 5yqsA
Sites not aligning to the query:
>N515DRAFT_3995 FitnessBrowser__Dyella79:N515DRAFT_3995
MKPSSRSRVRPLRFRRLAALALGLACAGHAVAMDAAQAERRAAELVARMTLEEKIAQLQS
SAPAIPRLGVPAYDWWSEGLHGTARAGYATVFPQAIGLAASWNAALLHEVGEVVSTEARA
KYNLAGRGDHPRYHGLSIWSPNINIFRDPRWGRGQETYGEDPFLTGTLATRFVRGIQGDD
PAELKAAATPKHFAVHSGPEKGRHGFDSHTPPHDLEDTYLPAFRMAVTEGQAASVMCAYN
ALEGTPACASPLLLQERLRRDWRFAGYVVSDCDAVDDMTQFHHYKPDNAGSSAAAVAAGT
DLDCGIAYAALGEAVRKGQVSEAVLDQAARRLFAARYRMGMLDEPNGPYATLGAADINSP
AHRALALRAARESIVLLKNEGGALPLKQDTRIAVIGPNADALNILEANYHGTAVDPVTPL
AGLRKQFGAARVSYAQGATLAQGVSVPVPASALRTGGKDAGPGLRGEYFDHADFNGKPRL
VRTDHRIDFDWDEVPPAKGFAAANYAVRWTGDLLPPGAGDYNLNVHIDRCFDCKGHDPVR
LYVDGKLVLDDHGKDYDLNVPLHFADTRPRPLKLELRHSGEDQGIRLQWNAPADAQLREA
KEAVAKADVVVAVVGLSPDVEGEELQVSVPGFSGGDRTDLALPATQQKLLEAAKASGKPL
VVVLTSGSAVALNWAKQHADAIVAAWYPGEEGGTAIADVLAGNYNPAGRLPVTFYASADD
LPKFDDYRMEGRTYRYFRGTPLFAFGEGLSYTRFAYEAPTLSSKTLKAGDKLGVDVRVRN
AGERDGDEVVQVYLSSSEEGAPRHSLVGFRRVAFKAGESKLVHFEIDPRQLSVVNLKGER
KVAPGKYVLFAGGQQPAGNTGTEFLIEGSLALPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory