Comparing N515DRAFT_4002 FitnessBrowser__Dyella79:N515DRAFT_4002 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
39% identity, 42% coverage: 498:852/853 of query aligns to 13:362/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
39% identity, 42% coverage: 498:852/853 of query aligns to 12:361/385 of 2yxxA
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
32% identity, 53% coverage: 1:448/853 of query aligns to 4:462/464 of 2hmfA
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
32% identity, 53% coverage: 1:448/853 of query aligns to 4:466/468 of 3c1mC
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
33% identity, 53% coverage: 1:448/853 of query aligns to 4:457/458 of 3c1nA
2j0xA Crystal structure of e. Coli aspartokinase iii in complex with lysine and aspartate (t-state) (see paper)
32% identity, 52% coverage: 2:445/853 of query aligns to 6:447/447 of 2j0xA
2j0wA Crystal structure of e. Coli aspartokinase iii in complex with aspartate and adp (r-state) (see paper)
32% identity, 52% coverage: 2:445/853 of query aligns to 6:447/447 of 2j0wA
P08660 Lysine-sensitive aspartokinase 3; Aspartate kinase III; AKIII; Lysine-sensitive aspartokinase III; EC 2.7.2.4 from Escherichia coli (strain K12) (see paper)
32% identity, 52% coverage: 2:445/853 of query aligns to 8:449/449 of P08660
1knwA Crystal structure of diaminopimelate decarboxylase
35% identity, 43% coverage: 488:853/853 of query aligns to 14:397/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
35% identity, 43% coverage: 488:853/853 of query aligns to 15:398/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
35% identity, 43% coverage: 488:853/853 of query aligns to 14:397/419 of 1ko0A
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 50% coverage: 2:431/853 of query aligns to 93:535/916 of O81852
2cdqA Crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine (see paper)
29% identity, 53% coverage: 1:453/853 of query aligns to 7:464/470 of 2cdqA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
33% identity, 42% coverage: 498:853/853 of query aligns to 27:393/418 of 4xg1B
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
32% identity, 42% coverage: 498:853/853 of query aligns to 25:368/393 of 4xg1A
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
34% identity, 37% coverage: 526:844/853 of query aligns to 70:402/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
34% identity, 37% coverage: 526:844/853 of query aligns to 66:398/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
34% identity, 37% coverage: 526:844/853 of query aligns to 66:398/434 of 1tufA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
32% identity, 41% coverage: 496:844/853 of query aligns to 28:389/422 of 6n2aA
O60163 Probable aspartokinase; Aspartate kinase; EC 2.7.2.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 53% coverage: 2:453/853 of query aligns to 19:500/519 of O60163
>N515DRAFT_4002 FitnessBrowser__Dyella79:N515DRAFT_4002
MKFGGTSVATLPRWQNIRELVASRRAEGARVLVVVSALTGITDALKQMCAQEDKGKRVEA
ARAIAQRHYDLLDHMQLAVPATLAERLSELAMLAEDGPGAMGELAWAALVQAHGELMSSA
LGAAFLSHAGLPTEWLDARDCLAAVALPNQNERTKLLSAMVEARPDPALNARLAELGEVF
ITQGFIAREAQGRTVLLGRGGSDTSASYFGALLKAQRVEIWTDVAGMFTANPRQVPGARL
LQRLDYEEAQEIASTGAKVLHPRCLSPLREPRVPMLIKDTNRPELEGTVIGPEVREHAPS
VKAISARKGITLVSMESVGMWQQVGFLADVFAQFKQHGLSVDLIGSAETNVTVSLDPTEN
LLDSDAIAALASDLAKVCRVKVIAPCAAITLVGRGMRSMLHTLSGVLAEFGQIRVHLISQ
SSNNLNLTFVVDENVVDDLLPHLHELLIAAGALRTDDSALFGPSWQALYGSGEVAAPAAS
WWRTAERERLLRLGAERTPRYVYHLPTVRQQARELKSLGAVDRLHYAVKANTHPAILKAL
AEEGFGFECVSPGELKAVLAAVPESAPLLFTPNFAPRADYEWALTTRATISLDALYQLEN
WGELFRGREIVLRVDLGRGLGHHEKVRTGGSGSKFGLPVELVDSFLRLADAHGVIVRGLH
AHLGSGILDEGHWGEVYGQLASLAERIGSVAFLDIGGGLGVPSHPGEARLDIAALDRVLR
SVKAAYPHYQLWMEPGRYLVADAGVLLARVTQQKGKGSWRYLGVDTGMNSLIRPALYEAW
HEIVNLTRLDEPATGLFQVVGPICESGDVLGTDRRLPEAQEGDVVLVAQAGAYGKVMSSP
YNMRDEAEEVILD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory