SitesBLAST
Comparing N515DRAFT_4010 FitnessBrowser__Dyella79:N515DRAFT_4010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
41% identity, 86% coverage: 21:173/177 of query aligns to 2:156/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (≠ A59), C41 (≠ S60), D42 (= D61), G44 (= G63), C46 (≠ G65), G47 (= G66), C49 (≠ D68), C61 (≠ A80), C101 (= C120), G102 (= G121), C104 (= C123), C136 (= C153), C138 (= C155)
- binding pterin cytosine dinucleotide: Q100 (≠ G119), C138 (= C155)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
42% identity, 86% coverage: 20:171/177 of query aligns to 1:153/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ Y58), C41 (≠ S60), G44 (= G63), C46 (≠ G65), G47 (= G66), C49 (≠ D68), C61 (≠ A80), C100 (= C120), G101 (= G121), C103 (= C123), C135 (= C153), C137 (= C155)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ G119), C137 (= C155)
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
39% identity, 82% coverage: 25:170/177 of query aligns to 4:149/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (≠ A59), C39 (≠ S60), G40 (≠ D61), G42 (= G63), C44 (≠ G65), G45 (= G66), C47 (≠ D68), C59 (≠ A80), C97 (= C120), C100 (= C123), Q101 (≠ T124), C132 (= C153), C134 (= C155)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (≠ G119), C134 (= C155)
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
38% identity, 80% coverage: 15:155/177 of query aligns to 1:154/1335 of G3X982
- C47 (≠ S60) binding
- C52 (≠ G65) binding
- C55 (≠ D68) binding
- C77 (≠ A80) binding
- Q116 (≠ G119) binding
- C117 (= C120) binding
- C120 (= C123) binding
- C152 (= C153) binding
- C154 (= C155) binding
Sites not aligning to the query:
- 264:271 binding
- 354 binding
- 358 binding
- 367 binding
- 411 binding
- 802 binding
- 807 A→V: No effect on kinetic constants with smaller substrates like benzaldehyde or phthalazine. Decreases substrate affinity and slightly increases catalytic efficiency for bulkier substrates like phenanthridine.
- 885 Y→M: Slightly decreases substrate affinity but no effect on activity with smaller substrates like benzaldehyde or phthalazine. Increases catalytic efficiency with bulkier substrates like phenanthridine or more charged substrates like N1-methylnicotinamide.
- 889 K→H: No effect on substrate affinity but decreases catalytic efficiency for smaller substrates like benzaldehyde or phthalazine. Increases substrate affinity and activity for bulkier substrates like phenanthridine.
- 1043 binding
- 1199 binding
- 1266 E→Q: Loss of activity with different N-heterocyclic compounds as substrates. 60% reduction of activity with benzaldehyde.
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
37% identity, 85% coverage: 24:173/177 of query aligns to 12:161/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (≠ S60), S50 (≠ G63), C52 (≠ G65), G53 (= G66), C55 (≠ D68), C67 (≠ A80), C106 (= C120), G107 (= G121), C109 (= C123), C141 (= C153), C143 (= C155)
- binding pterin cytosine dinucleotide: Q105 (≠ G119), C143 (= C155)
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
38% identity, 76% coverage: 22:155/177 of query aligns to 2:148/1262 of 3zyvB
- binding fe2/s2 (inorganic) cluster: Y39 (= Y58), C41 (≠ S60), G42 (≠ D61), G44 (= G63), C46 (≠ G65), C49 (≠ D68), T69 (vs. gap), C71 (≠ A80), C111 (= C120), G112 (= G121), C114 (= C123), C146 (= C153), C148 (= C155)
Sites not aligning to the query:
- active site: 716, 751, 829, 833, 861, 1207, 1208
- binding flavin-adenine dinucleotide: 227, 229, 230, 231, 232, 233, 234, 267, 303, 304, 312, 313, 316, 317, 319, 325, 326, 366, 392, 393
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
35% identity, 85% coverage: 24:174/177 of query aligns to 6:158/166 of P19921
- C42 (≠ S60) binding
- C47 (≠ G65) binding
- C50 (≠ D68) binding
- C62 (≠ A80) binding
- C102 (= C120) binding
- C105 (= C123) binding
- C137 (= C153) binding
- C139 (= C155) binding
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
35% identity, 85% coverage: 24:174/177 of query aligns to 4:156/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G63), H44 (≠ L64)
- binding fe2/s2 (inorganic) cluster: C40 (≠ S60), S43 (≠ G63), C45 (≠ G65), G46 (= G66), C48 (≠ D68), C60 (≠ A80), C100 (= C120), G101 (= G121), C103 (= C123), C135 (= C153), C137 (= C155)
- binding pterin cytosine dinucleotide: Q99 (≠ G119), C137 (= C155)
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
35% identity, 85% coverage: 24:174/177 of query aligns to 4:156/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G63), H44 (≠ L64)
- binding fe2/s2 (inorganic) cluster: I38 (≠ Y58), G39 (≠ A59), C40 (≠ S60), S43 (≠ G63), C45 (≠ G65), G46 (= G66), C48 (≠ D68), C60 (≠ A80), C100 (= C120), G101 (= G121), C103 (= C123), C135 (= C153), C137 (= C155)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
34% identity, 85% coverage: 24:173/177 of query aligns to 6:160/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ H62), G45 (= G63), E46 (≠ L64)
- binding fe2/s2 (inorganic) cluster: E40 (≠ Y58), C42 (≠ S60), S43 (≠ D61), G45 (= G63), C47 (≠ G65), G48 (= G66), C50 (≠ D68), C62 (≠ A80), Q100 (≠ G119), C101 (= C120), G102 (= G121), C104 (= C123), C136 (= C153), C138 (= C155)
- binding pterin cytosine dinucleotide: Q100 (≠ G119), C138 (= C155)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
33% identity, 82% coverage: 24:168/177 of query aligns to 6:151/157 of Q0QLF3
- C42 (≠ S60) binding
- C47 (≠ G65) binding
- C50 (≠ D68) binding
- C62 (≠ A80) binding
- C101 (= C120) binding
- C104 (= C123) binding
- C136 (= C153) binding
- C138 (= C155) binding
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
36% identity, 75% coverage: 24:155/177 of query aligns to 6:138/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ Y58), C42 (≠ S60), E43 (≠ D61), G45 (= G63), C47 (≠ G65), G48 (= G66), C50 (≠ D68), R60 (≠ S78), C62 (≠ A80), C101 (= C120), G102 (= G121), C104 (= C123), C136 (= C153), C138 (= C155)
- binding pterin cytosine dinucleotide: Q100 (≠ G119), C138 (= C155)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
33% identity, 93% coverage: 8:172/177 of query aligns to 49:227/229 of P77165
- C99 (≠ S60) binding
- C104 (≠ G65) binding
- G105 (= G66) binding
- C107 (≠ D68) binding
- C119 (≠ A80) binding
- C158 (= C120) binding
- C161 (= C123) binding
- C208 (= C153) binding
- C210 (= C155) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
33% identity, 92% coverage: 8:169/177 of query aligns to 2:173/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (≠ A59), C48 (≠ S60), D49 (= D61), G51 (= G63), C53 (≠ G65), G54 (= G66), C56 (≠ D68), C68 (≠ A80), C107 (= C120), G108 (= G121), C110 (= C123), C157 (= C153), C159 (= C155)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
32% identity, 82% coverage: 24:169/177 of query aligns to 5:151/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (≠ S60), S44 (≠ G63), H45 (≠ L64), C46 (≠ G65), G47 (= G66), C49 (≠ D68), C61 (≠ A80), C100 (= C120), G101 (= G121), C103 (= C123), C135 (= C153), C137 (= C155)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
32% identity, 82% coverage: 24:169/177 of query aligns to 4:150/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ Y58), C40 (≠ S60), S43 (≠ G63), C45 (≠ G65), G46 (= G66), C48 (≠ D68), C60 (≠ A80), C99 (= C120), G100 (= G121), C102 (= C123), C134 (= C153), C136 (= C155)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (≠ G119), C136 (= C155)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
36% identity, 83% coverage: 28:174/177 of query aligns to 8:158/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y58), G39 (≠ A59), C40 (≠ S60), G41 (≠ D61), G43 (= G63), Q44 (≠ L64), C45 (≠ G65), G46 (= G66), C48 (≠ D68), R58 (≠ S78), C60 (≠ A80), C100 (= C120), G101 (= G121), C103 (= C123), C137 (= C153), C139 (= C155)
- binding pterin cytosine dinucleotide: Q99 (≠ G119), C139 (= C155)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
37% identity, 75% coverage: 24:155/177 of query aligns to 3:136/450 of 2w54A
- binding flavin-adenine dinucleotide: G42 (= G63)
- binding fe2/s2 (inorganic) cluster: G38 (≠ A59), C39 (≠ S60), N40 (≠ D61), G42 (= G63), C44 (≠ G65), G45 (= G66), C47 (≠ D68), C63 (≠ A80), C103 (= C120), G104 (= G121), C106 (= C123), C134 (= C153), R135 (= R154), C136 (= C155)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: Q102 (≠ G119), C136 (= C155)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 189, 191, 192, 193, 194, 195, 196, 199, 213, 258, 259, 267, 268, 271, 272, 274, 275, 280, 281, 318, 324, 347
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
37% identity, 75% coverage: 24:155/177 of query aligns to 3:136/450 of 1jroA
- binding flavin-adenine dinucleotide: G42 (= G63), D43 (≠ L64)
- binding fe2/s2 (inorganic) cluster: E37 (≠ Y58), G38 (≠ A59), C39 (≠ S60), N40 (≠ D61), G42 (= G63), C44 (≠ G65), G45 (= G66), C47 (≠ D68), C63 (≠ A80), C103 (= C120), C106 (= C123), C134 (= C153), C136 (= C155)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 189, 191, 192, 193, 194, 195, 196, 258, 259, 268, 271, 272, 274, 280, 281, 318, 324
O54754 Aldehyde oxidase 1; Azaheterocycle hydroxylase 1; Retinal oxidase; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
43% identity, 67% coverage: 38:155/177 of query aligns to 21:150/1333 of O54754
Sites not aligning to the query:
- 806 V→E: Decreases substrate affinity and activity on benzaldehyde, phthalazine and acetaldehyde, while increases affinity for more hydrophobic aldehydes like retinal. Abolishes catalytic activity; when associated with R-884.
- 884 M→R: Abolishes catalytic activity on phthalazine and acetaldehyde. Decreases catalytic efficiency on benzaldehyde and retinal. Abolishes catalytic activity; when associated with E-806.
- 1265 E→Q: Abolishes catalytic activity.
Query Sequence
>N515DRAFT_4010 FitnessBrowser__Dyella79:N515DRAFT_4010
MAQAQALASNPTSSITPEKVRDGIEVEINGRPFRHTGDPDMPLLWYLRDVLRLTGTKYAS
DHGLGGADLVLVDKKPVSAASVPMHELADKKVTTVEGLAAADGKLHPLQQAFVDEDAIGC
GYCTPGWLIASLDLLNRHPQPSDDQIDQLPNLCRCGCQTRVRRAIKRASAAMAGGHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory