Comparing N515DRAFT_4011 FitnessBrowser__Dyella79:N515DRAFT_4011 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
25% identity, 94% coverage: 40:761/769 of query aligns to 5:718/732 of 8gy3C
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
26% identity, 55% coverage: 212:633/769 of query aligns to 10:436/761 of 1rm6A
Sites not aligning to the query:
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
26% identity, 55% coverage: 212:633/769 of query aligns to 18:444/769 of O33819
Sites not aligning to the query:
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 49% coverage: 202:581/769 of query aligns to 4:381/420 of 3hrdE
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 49% coverage: 202:581/769 of query aligns to 4:381/420 of 3hrdA
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 49% coverage: 202:581/769 of query aligns to 5:382/425 of Q0QLF2
Sites not aligning to the query:
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 48% coverage: 213:582/769 of query aligns to 15:376/748 of 5y6qC
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 56% coverage: 186:617/769 of query aligns to 2:415/732 of P77489
Sites not aligning to the query:
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
25% identity, 56% coverage: 186:617/769 of query aligns to 2:415/731 of 5g5gC
Sites not aligning to the query:
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
23% identity, 43% coverage: 288:614/769 of query aligns to 126:437/786 of 1t3qB
Sites not aligning to the query:
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
29% identity, 17% coverage: 628:760/769 of query aligns to 763:895/906 of 1dgjA
Sites not aligning to the query:
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
28% identity, 15% coverage: 650:761/769 of query aligns to 578:695/701 of 4zohA
Sites not aligning to the query:
7dqxD Crystal structure of xanthine dehydrogenase family protein
37% identity, 10% coverage: 653:729/769 of query aligns to 641:717/770 of 7dqxD
Sites not aligning to the query:
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
21% identity, 41% coverage: 181:496/769 of query aligns to 560:889/1361 of Q8GUQ8
Sites not aligning to the query:
Q7G9P4 Abscisic-aldehyde oxidase; Aldehyde oxidase 3; AO-3; AtAO-3; AtAO4; Indole-3-acetaldehyde oxidase; IAA oxidase; EC 1.2.3.14; EC 1.2.3.7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 15% coverage: 357:469/769 of query aligns to 719:835/1332 of Q7G9P4
>N515DRAFT_4011 FitnessBrowser__Dyella79:N515DRAFT_4011
MSRKNTPALPQRRRFLQVLAGTAGALIVGVRYAEAGDAPVPPAMLGDTLYGLGAYVRIDA
DGNVLIGARDPDTGTGVATALPRILADELDADWARVSVVPLGLGVENGNGEPRWIYGHQV
GGTGSSIPAAWHDLRQAGALARWLLMQAAARRLGVPADRLRTQGGAVISPDGRRFDYGSL
AEAASKVAPPTAPVPVKTPDRYTLIGQPAGDVDARAIVTGQAQFAIDNYFGDALVAVLVH
CPWVDGTLADKDFHEAEAVKGVVKIVELKPEPGLLPGETPLAPSVAVLAEDTWSALQARA
KLKLEWKPGPSGSESSAALEQQANDLVNPREATAKGAAAKDAAARDNTPTMRVRNDGDVD
GMAKKAARRVDATYVQPWLAHATAEPMNCLARVDKDRAVLVAPTQAPQRAWSVVQRLTGF
KPDQIEIRVPRVGGGYGRRLDHDFVAEAVMLAKLADRPVRLLWTREEDLAHDFYRPASVH
RLSATLDRKRQIVTWDQRMASASALARRGTPEQRLWTSEVDVNQLPAGLVPNYRSDWYAL
QSALPRGPHRGMPHVSNAFAVESFVDEIANALKEDPLVTRLRLLGEAREVPLQGGGSFDT
GRLINVLKLVADRIEWRNWLRTVNGLGMACWHMDGAYVAHAIETSLQGEKLNIERVVCAV
DVGRVINPLGLEGQIAGATLDALSAALNLAITFKDGQPQQRSYKDYPLASMAQLPDAVDV
IIVPGDRDPAAASFLAMPTAAPALANAVFRVSAVRVRRLPLMKGLLRLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory