Comparing N515DRAFT_4124 FitnessBrowser__Dyella79:N515DRAFT_4124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
53% identity, 97% coverage: 20:543/543 of query aligns to 9:524/524 of 3cv2A
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
53% identity, 97% coverage: 20:543/543 of query aligns to 14:529/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
53% identity, 97% coverage: 20:543/543 of query aligns to 14:529/529 of 3cuzA
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
50% identity, 96% coverage: 23:542/543 of query aligns to 10:501/501 of 3cuxA
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
46% identity, 95% coverage: 26:543/543 of query aligns to 31:542/554 of P30952
Sites not aligning to the query:
5cahA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 244:629/706 of 5cahA
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 246:634/711 of 6c2xA
Sites not aligning to the query:
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
26% identity, 59% coverage: 148:465/543 of query aligns to 319:653/729 of 6axeA
Sites not aligning to the query:
3sazA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(3-bromophenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 248:637/712 of 3sazA
6au9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with dioxine-phenyldiketoacid (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 248:638/712 of 6au9A
Sites not aligning to the query:
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 248:634/711 of 5cjmA
Sites not aligning to the query:
5cc7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-6-carboxylic acid
25% identity, 68% coverage: 97:465/543 of query aligns to 245:631/704 of 5cc7A
Sites not aligning to the query:
5cc6A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-5-carboxylic acid
25% identity, 68% coverage: 97:465/543 of query aligns to 242:628/701 of 5cc6A
Sites not aligning to the query:
6axbA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-naphthyldiketoacid (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 248:639/715 of 6axbA
Sites not aligning to the query:
3s9zA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-bromophenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 248:639/715 of 3s9zA
Sites not aligning to the query:
3sb0A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-chloro-6-fluoro-3-methylphenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 244:631/708 of 3sb0A
Sites not aligning to the query:
6c7bA Crystal structure of mycobacterium tuberculosis malate synthase in complex with methoxynaphthyldiketoacid (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 248:635/710 of 6c7bA
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
24% identity, 68% coverage: 97:465/543 of query aligns to 248:640/717 of 5c9rA
Sites not aligning to the query:
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
25% identity, 68% coverage: 97:465/543 of query aligns to 247:635/712 of 6bu1A
Sites not aligning to the query:
5cc3A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6-bromo-1h-indole-2-carboxylic acid
25% identity, 68% coverage: 97:465/543 of query aligns to 248:638/715 of 5cc3A
Sites not aligning to the query:
>N515DRAFT_4124 FitnessBrowser__Dyella79:N515DRAFT_4124
MAVPQERLPQSSIRIEGETGPGHESILTPAALAFLADLHHRFNDRRLDLLAARRTRQARY
DAGELPDFRADTLAIREGRWTVGKIPAALQDRRVEITGPVERKMIINALNSGAKVFMADF
EDSSAPTLANQFDGQINLRDAVNGTIGYTSPEGKTYRVGHDPAVLVVRPRGWHLPERHLT
VDGEPMSGALVDFGLYAFHNARALQARDRGPYFYLPKLEAMEEAALWHEAMAAAEEALGL
PAHCMKATVLIETLPAVFQMHEILHALRERAVGLNCGRWDYIFSYLKTFRGHRDRLLPER
GQVLMTVPFLKAYSELLIQTCHRRGAFAMGGMAAQIPIKGDEAANEAALAKVRADKLREV
QAGHDGTWVAHPALVPVAREIFDQYMPSPNQLNVARADVQASRDQLIAPCAGTISRAGFD
NNVEVALRYTAAWLDGLGCVPIHHLMEDAATAEIARAQLWQWLHHPGNPAGGTPAGDGLE
FTDHAPIDFALFDQALAAHTHRLRASTHPGAARADDAAALLATLTHAEQLGDFLTLPAYD
RLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory