Comparing N515DRAFT_4210 N515DRAFT_4210 glucokinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
39% identity, 93% coverage: 10:324/339 of query aligns to 5:310/320 of 1sz2B
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
27% identity, 67% coverage: 13:240/339 of query aligns to 30:281/374 of 6vzzA
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
25% identity, 81% coverage: 13:286/339 of query aligns to 30:329/374 of 8dtcA
>N515DRAFT_4210 N515DRAFT_4210 glucokinase
MSSTSSAKTLLADLGGTNVRFALADPALPQPLLLDSVRRYRVKDFPSMADTIRQYFADSG
LSAGRAVIAAAGRIVDGETVKVTNNPWQVSAHGLAADLKFDSVRLINDFAAQGMAVPLLA
CNELQPVGAPQPPKIGAHHSQTFVVVGPGTGLGVAGLLLRDGRWTVLETEGGHAGFAAHT
AEDVEILHRLNARFGRVSNERMICGNGLVNLYLALADIEGLKAEEYTPEDITTRANAGTD
PLCVRTVETLAGIFGSVAGDLVLSLGGWDGVFLTGGVLPILLPWLQHGGFRERFESKGRF
KETMEQVPTVAMMHAETGLLGAAAFAVLESGRPLVPAAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory