Comparing N515DRAFT_4291 FitnessBrowser__Dyella79:N515DRAFT_4291 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
66% identity, 99% coverage: 3:393/393 of query aligns to 2:387/387 of P0A799
Sites not aligning to the query:
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
66% identity, 99% coverage: 3:393/393 of query aligns to 1:386/386 of 1zmrA
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
59% identity, 99% coverage: 3:393/393 of query aligns to 2:392/392 of 4feyA
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
59% identity, 99% coverage: 4:391/393 of query aligns to 2:388/389 of 4ng4B
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
48% identity, 98% coverage: 7:390/393 of query aligns to 6:394/394 of P40924
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
48% identity, 98% coverage: 7:390/393 of query aligns to 6:394/394 of 1phpA
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
48% identity, 98% coverage: 7:390/393 of query aligns to 6:394/394 of P18912
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
44% identity, 99% coverage: 5:392/393 of query aligns to 3:398/398 of 1vpeA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
45% identity, 97% coverage: 5:387/393 of query aligns to 4:394/654 of P36204
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
40% identity, 98% coverage: 7:392/393 of query aligns to 9:421/440 of P07378
P00560 Phosphoglycerate kinase; EC 2.7.2.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
44% identity, 99% coverage: 1:390/393 of query aligns to 3:415/416 of P00560
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
41% identity, 97% coverage: 7:387/393 of query aligns to 5:412/415 of 16pkA
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
41% identity, 97% coverage: 7:387/393 of query aligns to 5:412/415 of 13pkA
1qpgA 3-phosphoglycerate kinase, mutation r65q (see paper)
44% identity, 99% coverage: 1:390/393 of query aligns to 2:414/415 of 1qpgA
3pgkA The structure of yeast phosphoglycerate kinase at 0.25 nm resolution (see paper)
43% identity, 99% coverage: 1:390/393 of query aligns to 2:414/415 of 3pgkA
O60101 Phosphoglycerate kinase; EC 2.7.2.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
43% identity, 99% coverage: 1:390/393 of query aligns to 3:414/414 of O60101
1kf0A Crystal structure of pig muscle phosphoglycerate kinase ternary complex with amp-pcp and 3pg (see paper)
42% identity, 98% coverage: 1:387/393 of query aligns to 2:413/416 of 1kf0A
1vjcA Structure of pig muscle pgk complexed with mgatp (see paper)
41% identity, 98% coverage: 1:387/393 of query aligns to 2:413/416 of 1vjcA
2y3iA The structure of the fully closed conformation of human pgk in complex with l-adp, 3pg and the tsa aluminium tetrafluoride (see paper)
41% identity, 98% coverage: 1:387/393 of query aligns to 1:412/414 of 2y3iA
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
41% identity, 98% coverage: 1:387/393 of query aligns to 3:414/417 of P09041
>N515DRAFT_4291 FitnessBrowser__Dyella79:N515DRAFT_4291
MSSFLRMSDLDLRGKRVLIREDLNVPIEDGRITSTQRLDASLPTIKAARDAGARVMVISH
LGRPKEGQFDAESSLAPVAKWLGDKLGTPVRLIADYLGGVDVAEGEVVVLENCRMNVGEG
KDDEALSKKYAALCDIFVMDAFGTAHRAQASTHGVIKYAPVAAAGPLLSAELDALGKALE
HPAHPLLAIVAGSKVSTKLTLLENLIGKVDQLIVGGGIANTFIAAAGYGVGNSLYEPDLL
DAAKKVIADAKRRGAEVPMPVDVVVAPEFSAHAPATVKPVDQVKDGEMILDIGPQTAKNY
AALIAKAGTVVWNGPVGVFEFDAFGKGTETLARAVASSDAFSIAGGGDTLAAVEKYGIEK
DVSYISTGGGAFLEFLEGKELPAVAALKARAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory