Comparing N515DRAFT_4292 FitnessBrowser__Dyella79:N515DRAFT_4292 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
52% identity, 97% coverage: 3:217/221 of query aligns to 1:213/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
53% identity, 96% coverage: 5:217/221 of query aligns to 1:211/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
53% identity, 96% coverage: 5:217/221 of query aligns to 1:211/212 of O86043
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
46% identity, 97% coverage: 6:219/221 of query aligns to 7:212/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
46% identity, 97% coverage: 6:219/221 of query aligns to 4:209/212 of 2cz2A
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
44% identity, 97% coverage: 6:219/221 of query aligns to 3:208/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
43% identity, 97% coverage: 6:219/221 of query aligns to 7:212/216 of O43708
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
50% identity, 98% coverage: 5:221/221 of query aligns to 8:216/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
50% identity, 98% coverage: 5:221/221 of query aligns to 10:218/222 of 4kdyA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
46% identity, 98% coverage: 3:219/221 of query aligns to 1:216/216 of 4pxoA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
40% identity, 98% coverage: 2:218/221 of query aligns to 3:226/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
40% identity, 98% coverage: 2:218/221 of query aligns to 1:224/228 of 3n5oA
8a0pA Crystal structure of poplar glutathione transferase u20 in complex with morin (see paper)
32% identity, 77% coverage: 3:173/221 of query aligns to 1:154/216 of 8a0pA
Sites not aligning to the query:
8a0rA Crystal structure of poplar glutathione transferase u20 in complex with pinocembrin (see paper)
32% identity, 77% coverage: 4:173/221 of query aligns to 1:153/215 of 8a0rA
Sites not aligning to the query:
8a0qA Crystal structure of poplar glutathione transferase u20 in complex with baicalein (see paper)
32% identity, 77% coverage: 4:173/221 of query aligns to 1:153/215 of 8a0qA
Sites not aligning to the query:
8a0oA Crystal structure of poplar glutathione transferase u20 in complex with galangin (see paper)
32% identity, 77% coverage: 4:173/221 of query aligns to 1:153/215 of 8a0oA
Sites not aligning to the query:
8a0iA Crystal structure of poplar glutathione transferase u20 in complex with glutathionylphenylacetophenone (see paper)
32% identity, 77% coverage: 4:173/221 of query aligns to 1:153/215 of 8a0iA
Sites not aligning to the query:
8a08A Crystal structure of poplar glutathione transferase u20 in complex with glutathione (see paper)
32% identity, 77% coverage: 4:173/221 of query aligns to 1:153/215 of 8a08A
7db3A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp011-bound form
31% identity, 91% coverage: 6:207/221 of query aligns to 4:196/223 of 7db3A
7dazA Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp015- and gsh-bound form
31% identity, 91% coverage: 6:207/221 of query aligns to 4:196/219 of 7dazA
Sites not aligning to the query:
>N515DRAFT_4292 FitnessBrowser__Dyella79:N515DRAFT_4292
MTSDLVLYGYWRSSAAYRVRIALNLKGLAYESRPVHLVRDGGEQHQQAYRALNPQELVPC
LVDGAQVLTQSMAIMEYLDETHPAPALLPPDAAGRARVRSLAQLLACDVHPLGNLRVLQY
LGNELHADEAVRGSWSRHWIGEGFRALEAMLAGNAATGRFCHGDQPTLADACLVPQHYNA
LRWKLPMEEFPTIRRIVEACQALDAFKRAVPEAQPDAPAVD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory